KEGG   Catenulispora acidiphila: Caci_5470Help
Entry
Caci_5470         CDS       T00967                                 

Definition
(GenBank) arginine biosynthesis bifunctional protein ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
cai  Catenulispora acidiphila
Pathway
cai00220  Arginine biosynthesis
cai01100  Metabolic pathways
cai01110  Biosynthesis of secondary metabolites
cai01130  Biosynthesis of antibiotics
cai01210  2-Oxocarboxylic acid metabolism
cai01230  Biosynthesis of amino acids
Module
cai_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Caci_5470
Enzymes [BR:cai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     Caci_5470
    2.3.1.35  glutamate N-acetyltransferase
     Caci_5470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: ACU74329
UniProt: C7Q9I3
LinkDB All DBs
Position
complement(6307807..6308958)
Genome map
AA seq 383 aa AA seqDB search
MSVTSAKGFRASGIAAGIKDSGNPDLALVVNDGPLTAAAGVFTSNRVKAAPVVWSEQVLK
SGAVKAVVLNSGGANACTGPAGFQDTHKTAEELAALLDASAAEVAVCSTGLIGVRLPMEA
LLSGLKTAAGALAADGGAAAATAIMTTDTVAKTAEARGTGYAVGGMAKGAGMLAPGLATM
LVVLTTDAVADAGVLDSVLRAATKVTFDRVDSDGCMSTNDTVLLLASGASETVPDLAEFQ
AAVTSVCADLARQLIGDAEGATKDIAVEVVRAASEDEAVQVAKAVTRSNLFKCAMYGNDP
NWGRVLSAVGTTDAAFEPDQLSVAINNVWVCRDGGVGEDRDLVDLTGREVKVTVDLAAGT
SSATVWTNDLTPGYVHENSAYSS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcacctccgcgaagggcttccgggcttccgggatcgccgccggaatcaaggac
tccgggaacccggacctcgcgctggtcgtcaacgacggtccgctgaccgccgccgccggc
gtcttcacctccaaccgcgtgaaggccgccccggtcgtgtggtccgagcaggtcctcaag
agcggcgcggtcaaggccgtggtcctgaactccggcggcgcgaacgcctgcaccggcccg
gccggcttccaggacacgcacaagaccgccgaggaactcgccgcgctgctggacgcctcg
gccgccgaggtcgccgtgtgctccaccggcctgatcggcgtccggctgccgatggaggcg
ctgctgtccgggctgaagaccgccgccggggcgctcgccgccgacggcggagcggccgcc
gcgaccgcgatcatgaccaccgacaccgtcgccaagaccgccgaggcgcgcggcaccggc
tacgccgtcggcggcatggccaagggcgccgggatgctggcgccgggtctggccacgatg
ctcgtcgtgctgaccaccgacgcggtggccgacgccggcgtgctcgactccgtgctgcgc
gccgccacgaaggtcaccttcgaccgcgtcgactccgacggctgcatgtccacgaacgac
accgtcctgctgctcgcctccggtgcctccgagaccgtgccggacctcgccgagttccag
gccgccgtcacctcggtgtgcgccgacctcgcgcgccagctcatcggcgacgctgaaggc
gcgaccaaggacatcgccgtggaggtcgtccgcgccgccagcgaggacgaggcggtccag
gtcgccaaggctgtcacccgcagcaacctgttcaagtgcgcgatgtacggcaacgacccg
aactggggtcgggtcctgtccgcggtcgggaccaccgacgcggcgttcgagcccgaccag
ctctcggtcgccatcaacaacgtctgggtctgccgcgacggcggcgtcggtgaggaccgc
gacctggtcgacctgaccggccgcgaggtcaaggtcaccgtcgacctcgccgccggcacc
tcctcggcgaccgtctggaccaacgacctgacgcccgggtacgtccacgagaactcggcg
tactcctcatga

DBGET integrated database retrieval system