KEGG   Catenulispora acidiphila: Caci_5866Help
Entry
Caci_5866         CDS       T00967                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
cai  Catenulispora acidiphila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ACU74724
UniProt: C7QDV0
LinkDB All DBs
Position
complement(6773821..6774930)
Genome map
AA seq 369 aa AA seqDB search
MAEVNLPVLPPVEPMLAKSAAKVPTGDYLYEPKWDGFRCIVFRDGDRVVLGSRGGKELGR
YFPELVESLKEALPARCVVDGEIVVVVDSRLDFDRLSDRIHPAASRVKLLAERTPASFIG
FDLLALGDRDLTAEPFADRRAALLSAVAKHEYVHVTRATDDPELAATWFQHFEGAGLDGV
VAKPSQGAYTPGERSMVKIKHERTADVVVAGYRLHKTGPIVGSLMLGLYGEDGILNYVGG
SSAFTMARRKELIDELAPYLLPEGESHPWVDAPDEGDGDSGSGSGSDSEHRRPGTLNRWN
AGKDVSFIALRPELVCEVRYDQLQGDRFRHNGRFVRWRPDRDAASCSYEQLDVPAAYDLA
DVFGDAGQD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaggtgaacctgccggtgctgcccccggtcgagccgatgctggccaagtccgcc
gcgaaggtcccgaccggcgactacctgtacgagcccaagtgggacggcttccgctgcatc
gtcttccgcgacggcgaccgggtcgtgctcggcagccgcggcggcaaggagctggggcgc
tacttcccggagctcgtcgagtctttgaaggaagcgctgccggcgcgctgcgtcgtggac
ggcgagatcgtggtggtcgtggacagccgcctggacttcgaccggctcagcgaccgcatc
caccccgccgcctcccgggtgaagctgctcgccgagcgcaccccggcctccttcatcggc
ttcgacctgctcgcgttgggcgaccgcgacctgaccgccgagcccttcgccgaccgccgc
gccgcgttgctcagcgccgtcgccaagcacgagtacgtgcacgtcacccgcgccaccgac
gacccggagctggccgcgacctggttccagcacttcgagggcgccggcctggacggcgtc
gtcgcgaagccctcgcagggtgcgtacacccccggcgagcgcagcatggtgaagatcaag
cacgagcgcaccgccgacgtggtcgtcgccggctaccgcctgcacaaaaccggcccgatc
gtcggctccctgatgctcggtctctacggcgaggacggcatcctgaactacgtcggcggc
tccagcgccttcaccatggcgcgccgcaaggagctgatcgacgaactggcgccgtacctg
ctgcccgaaggcgagtcgcacccctgggtcgacgcccccgacgaaggcgacggcgacagt
ggcagcggcagcggcagtgacagcgagcaccgccgccccggaaccctgaaccgctggaac
gccggcaaggacgtctcgttcatcgccctgcgccccgagctggtctgcgaagtgcgctac
gaccagctgcagggcgaccggttccggcacaacggacgcttcgtgcgatggcggccggac
cgcgatgccgcgtcgtgctcctacgagcagctggacgtgccggccgcctatgacctggca
gatgtcttcggcgacgccgggcaggactga

DBGET integrated database retrieval system