KEGG   Catenulispora acidiphila: Caci_6974
Entry
Caci_6974         CDS       T00967                                 

Definition
(GenBank) cellulose-binding family II
  KO
K20847  glucan 1,6-alpha-isomaltosidase [EC:3.2.1.94]
Organism
cai  Catenulispora acidiphila
Brite
KEGG Orthology (KO) [BR:cai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Caci_6974
Enzymes [BR:cai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.94  glucan 1,6-alpha-isomaltosidase
     Caci_6974
SSDB
Motif
Pfam: CBM_2 fn3 Melibiase_C fn3_2 CBM_6
Other DBs
NCBI-ProteinID: ACU75804
UniProt: C7Q3N9
LinkDB
Position
complement(8066673..8069489)
AA seq 938 aa
MAISRRDLLKVGGTVVVGGSLLSAGSGSAAAASRGRGALVGSTAVAVSAVGTDSVDRDSV
FTRGGSGPLYWSTYGYDYPNNNAQSQASWQANVTWVAKNLKPYGIDMACTDGWVDYTQAT
NSNGYILNYQDSWAMGWAGMSSYLSGLGLKMGVYYNPLWVTKSAYNDPSKTVVGRPDIPI
SSIVTAGDFFGGNKGTQEIYWVDVTKDGAKEFVQGYVNYFKQLGAVYLRGDFWAWYETGY
DQNEGTVGVAHGSANYATALGWISEAAGDGLEVSVVMPNLLNHGQNERRYGDLIRIDDDC
GSGGWNFLDGGRSSWQNYWTQWHTPFLGFTGFSDISGRGQMILDGDVLEMNSFGSDDERR
TALTLFAMAGSPLIVGDRSDNIGSYLSFWQNNDILNINKAGFVGKPYYHNANPFSSDPTS
RDPETWTGQLPDGTWLVALFNTTYSSVTKSIDFAGALGLAAGGTVHDVWNNTNLGQMTSY
SASLPMHGVSLIKITPAGSGAPVYQSQVAAWGGGAMFDNAASGFSGNGYVDGLGSVGARV
VFGVTGAGGTTPVTIRYANSGSAASLTISAKNVAGTVSGSTSVSLPGTGGAGTWSTVTVN
LALAAGTNLITLERTSTDSGSVNLDSIQVGASSGGSTPPGAPGTPAASAITSNAVTLTWS
AAAAGSNPIAGYQVYQVGSPDTVVASTAAGTLTATISGLTAATSYSFYVKAKDSAGTVGA
ASGTTAVTTAGSGGSTPPGAPGTPAASTITATAVTLTWSAAAAGSNAIAGYQVYEVGSPD
TVVASTAAGTLTATISGLMSATQYGFYVKAKDSAGALGAASATKTVTTAAVSAGAAVSYA
VQSDWGSGFSALVTITNTGTSAINNWTLGFTFAGNQHVTNGWNATWSQSGANVTASSESF
NGAIAPGASVQIGFTGTYSGANAKPTAFTINGQPATTQ
NT seq 2817 nt   +upstreamnt  +downstreamnt
atggcgatctcacggcgagatctgctcaaggtcggcggaacggtggtggtcggcgggtct
ttgctgtcggccggttccggttcggcggccgctgcgtcgcgtggcaggggcgccctggtg
ggctcgacggctgtggctgtgtccgcggtggggacggactcagtcgatcgtgacagcgtg
ttcacccggggcggttccgggccgctgtactggtccacgtacggctacgactacccgaac
aacaacgctcagtcgcaggccagctggcaggcgaacgtcacctgggtggcgaagaacctc
aagccctacggcatcgacatggcctgtaccgacggctgggtcgactacacccaggcgacc
aactccaacggctacatcctgaactaccaggacagctgggccatgggctgggccgggatg
tcgtcgtacctgtccgggctcgggctgaagatgggggtctactacaaccccctgtgggtg
accaagagtgcgtacaacgacccgtccaagacggtggtcgggcgtccggacatcccgatc
tcgtcgatcgtcaccgcgggggacttcttcggcgggaacaagggcacccaggagatctac
tgggtggacgtgaccaaggacggcgccaaggagttcgtccagggctacgtcaactacttc
aagcagctgggcgcggtctacctgcgcggcgacttctgggcgtggtacgagaccggctac
gaccagaacgagggcacggtcggcgtggcgcacggcagcgccaactacgccaccgccctg
ggctggatcagcgaggccgccggggacgggctggaagtcagtgtcgtgatgcccaacttg
ctcaaccacggccagaacgagcggcgctacggcgacctgatccgcatcgacgacgactgc
ggcagcggcggctggaacttcctggacggcggccggtcgagctggcagaactactggacc
cagtggcacaccccgttcctgggcttcaccggcttctccgatatctccgggcgcggtcag
atgatcctggacggcgacgtcctggagatgaacagcttcggcagcgatgacgagcgccgc
acggcactgacactgttcgccatggccggctcgccgctgatcgtcggcgaccggtccgac
aacatcggctcctacctcagcttctggcagaacaacgacatcctgaacatcaacaaggcc
gggttcgtcggcaagccctactaccacaacgccaatccgttctcgtcggatcccacgagc
cgggacccggagacgtggacgggccagctgcccgacggcacctggctggtcgcgttgttc
aacaccacctactccagcgtcaccaagtcgatcgacttcgccggcgctctggggctcgcg
gccggcggcacggtccacgacgtgtggaacaacaccaacctgggccagatgacgtcgtat
tcggcgtccctgccgatgcacggggtgtccctgatcaagatcacgccggccgggtccggg
gcgccggtctaccagtctcaggtggctgcctggggcggcggggcgatgttcgacaacgcc
gcgtccggcttcagcggcaacggctacgtggacggactgggtagcgtcggcgcccgggtc
gtcttcggcgtcaccggtgcgggcggcacgactccggtcaccatccgatacgccaactcc
ggcagcgccgcgagcctgaccatatcggccaagaacgtggcgggcacggtctcgggcagc
acctcggtcagcctcccgggcaccggcggcgccggtacctggagcacggtcaccgtcaac
ctcgcgctggccgcggggacgaacctgatcaccctggagcgcacctccaccgattccgga
tcagtgaatctggactcgatccaagtcggcgcctcctcaggaggctccaccccgcccggc
gcccccggcacaccggcggcttcggccatcacctccaacgcggtgaccctgacgtggagc
gcggcagccgcgggcagcaacccgatcgccggataccaggtctaccaggtcggatcaccc
gacaccgtggtcgcttccaccgccgccggaaccctcaccgcgaccatcagcggcctgact
gcggcgacgagctacagcttctacgtcaaggccaaggacagcgcgggaaccgtcggcgcc
gcatccggaacgacggcagtcaccactgccggctccggcggctcgaccccgcccggcgca
ccgggcacaccggcagcgtccaccatcaccgcgaccgcggtgaccctgacgtggagcgcg
gcagccgctggcagcaacgcgatcgccggataccaggtctacgaggtcggatcgcccgac
accgtggtcgcttccaccgctgccggaaccctcaccgcgaccatcagtggcctgatgagc
gccacgcagtacggcttctacgtcaaggccaaggacagcgccggagctctcggcgccgct
tcagccacgaaaaccgtgacgacggctgcggtttcggctggagccgcggtctcctacgcc
gtccaaagcgactggggctcgggcttcagcgccttggtgacgatcaccaacaccggtacc
agcgcgatcaacaactggaccctcggattcaccttcgcgggcaaccagcacgtcaccaac
ggctggaacgccacctggtcccagagcggcgcgaacgtcaccgcctccagcgagtccttc
aacggcgcgatcgccccgggcgcctcggtccagatcggcttcaccggtacctacagcggt
gccaacgccaagccgaccgccttcacgatcaacgggcagcccgccaccacgcagtga

DBGET integrated database retrieval system