KEGG   Catenulispora acidiphila: Caci_7706Help
Entry
Caci_7706         CDS       T00967                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
cai  Catenulispora acidiphila
Brite
KEGG Orthology (KO) [BR:cai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Caci_7706
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Caci_7706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ACU76530
UniProt: C7QCR7
LinkDB All DBs
Position
8943317..8943718
Genome map
AA seq 133 aa AA seqDB search
MFSRIFSRTSAVHAHCDLPCGVYDPAQARIEAESVLAITKKYADNSDASFRTRAILIKEQ
RSELVKHHLWVLWTDYFKAPHFEKYPQLNTLFNEATKLAGASGTKGSMDSAVAEELLAKI
EEISKIFWETKQA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgcggatcttctcccgcacctcagctgtccacgctcactgcgacctgccgtgc
ggcgtctacgacccggcgcaggcccggatcgaggccgagtcggtgctggccatcaccaag
aaatacgccgacaactccgacgcgtccttccgcacccgcgccatcctgatcaaggagcag
cgctccgagctggtcaagcaccacctgtgggtgctgtggaccgactacttcaaggctccg
cacttcgagaagtacccccagctgaacacgctgttcaacgaggccaccaagctggccggc
gcgagcggcaccaagggcagcatggactcggccgtggccgaggagctgctggccaagatc
gaggagatctccaagatcttctgggagaccaagcaggcctga

DBGET integrated database retrieval system