KEGG   Campylobacter iguaniorum: CIG1485E_1225Help
Entry
CIG1485E_1225     CDS       T03252                                 

Gene name
mrdA
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
caj  Campylobacter iguaniorum
Pathway
caj00550  Peptidoglycan biosynthesis
caj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:caj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CIG1485E_1225 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CIG1485E_1225 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:caj01011]
    CIG1485E_1225 (mrdA)
Enzymes [BR:caj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CIG1485E_1225 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:caj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CIG1485E_1225 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DltD
Motif
Other DBs
NCBI-ProteinID: AII15059
UniProt: A0A076FGW5
LinkDB All DBs
Position
complement(1220485..1222287)
Genome map
AA seq 600 aa AA seqDB search
MRMRIVYAILISVWTILLVRIYYLSIKSNEYYEEIAQNNAIKTELIAPVRGQVFDIKGNP
LAVNRLGFSVSLKPHLRKDDKTLKDEIEALASTFTDLNSTKLIKNYLKSDSPYNQEFVEV
VEFIDYDAMLPHFAKLSLRPNLLIKPASKRHYPYDYLASHVIGYVGRANQKDIQTDELTK
LTNYTGRSGIERFYNSVLQGASGERKTKVTALNQEIEEIYYKGATSQNIKLTLDLELQKF
VTEAFGKDAGAVVVMSLKDGAILAAGSFPEYNLNPFVTGISQKEWDEIIKDLDKPFTNKL
VNALYPPGSVVKMAMGMAFFNSGKIDPTTKIMCDPYFELGGRKFRNWKNYGYENMTIVEA
IKESCDTYFYRGAYKVGIDDISPVLEKFGFGVKSGIDLPNEYIGVVPSKEWKRTKTKEPW
YQGDTLNTSIGQGSFLVTPVQVARDTAIFATGLDVTPHFLHSIDENVTKWEVRDILSDKE
KANLAYVRKGMYQTANIFGGTGFRALSSANIRLGAKTGTAQVVGISQTDKNRINENDMKY
YERSHAWITTYGPVEEPAFVVTAMVEHGGHGGSAAGPIVAKIYNKLIELGYIDKKYLKKK
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgcgtatagtgtatgctattttgatatctgtttggactattttgcttgttagg
atctattatctaagtatcaaatcaaatgaatattacgaagaaatcgctcaaaataatgcg
ataaaaacagagctcatagctcctgttcgtgggcaggtttttgatatcaaaggtaatccc
ttagctgtaaataggcttggctttagcgtgtcgcttaaaccgcatttaagaaaagatgat
aaaacactaaaagatgagatagaagctctagcctccacatttacggatttaaactcaaca
aaacttataaaaaattatctcaaaagcgactctccgtataatcaagaattcgtcgaagtc
gttgagtttatagactatgacgccatgcttccacactttgcaaagcttagtttaaggcca
aatttactcataaaaccagctagcaaaagacactatccttatgattatttagcaagccac
gttattggatatgtcggcagagcaaaccaaaaagatatacaaactgatgagcttacgaag
cttactaattacaccggaagaagcgggattgaaagattttacaatagcgtattgcaaggt
gctagtggagagagaaagacaaaggtaactgccctaaatcaagagatcgaagagatctat
tacaagggtgcaactagtcaaaatatcaagcttactttggatttggagcttcaaaaattt
gtcaccgaagcctttggcaaggacgctggagctgttgtagtaatgagcttaaaagatgga
gccatacttgctgctggaagcttcccagagtataatctaaatccatttgtcacaggaatc
agccaaaaagagtgggacgagatcataaaagacctcgataagccttttactaataagctg
gtaaatgctctttatccaccaggaagtgtcgtcaaaatggctatgggaatggcgtttttt
aatagcggcaagatagatcctactacaaaaattatgtgtgatccgtattttgagcttggt
ggtaggaaatttagaaactggaaaaactatggctatgaaaatatgactatagtcgaagcc
ataaaagagagttgtgatacatatttttatagaggtgcttataaggtcggcatagatgat
atatctccagtgcttgaaaaatttggctttggggtcaagagcggtatagaccttccaaac
gaatacataggcgtcgttcctagtaaagagtggaagaggacaaagacaaaagagccttgg
tatcaaggcgacacgctaaacacatccataggacaaggaagcttccttgtcacgccagtc
caagtagcaagagatacggcgatatttgccacaggacttgacgtgacaccgcatttttta
catagcattgatgaaaacgtgacaaaatgggaagttagagatattttgagcgacaaagaa
aaggcaaatttggcttacgtaagaaaaggtatgtatcaaactgcaaatatatttggtgga
actggatttagggctttaagttcggcgaatatccgtcttggtgccaaaactggaaccgct
caagtagtcggcatctcgcaaactgacaaaaacagaattaatgaaaacgatatgaaatac
tatgaacgctcacacgcttggatcactacttatggaccagtagaagagccagcatttgtg
gtgactgcgatggtcgagcatggcggacatggcggtagtgcagctggaccgatcgtcgca
aaaatctataataaactaatcgaactaggctatatagataagaaatatttgaagaaaaag
taa

DBGET integrated database retrieval system