KEGG   Campylobacter iguaniorum: CIG1485E_1423Help
Entry
CIG1485E_1423     CDS       T03252                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acp] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
caj  Campylobacter iguaniorum
Pathway
caj00061  Fatty acid biosynthesis
caj00780  Biotin metabolism
caj01100  Metabolic pathways
caj01130  Biosynthesis of antibiotics
caj01212  Fatty acid metabolism
Module
caj_M00083  Fatty acid biosynthesis, elongation
caj_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:caj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CIG1485E_1423 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CIG1485E_1423 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CIG1485E_1423 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:caj01004]
    CIG1485E_1423 (fabI)
Enzymes [BR:caj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CIG1485E_1423 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CIG1485E_1423 (fabI)
Lipid biosynthesis proteins [BR:caj01004]
 Fatty acid synthase
  Component type
   CIG1485E_1423 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: AII15246
UniProt: A0A076FB72
LinkDB All DBs
Position
complement(1414690..1415514)
Genome map
AA seq 274 aa AA seqDB search
MIMNGKKGLIVGVANKMSIAYGIAKACKDQGAQLAFTFLNDAIKKRVEPIASELGSELIY
ELDVNNKEHLDSLADKIKADFGEIDFVVHAVAYAPKEALEGEFINTTKEAFDIAMGTSVF
SLISLTRAVLPVLKDGGSILTLTYLGGPKFVPHYNVMGVAKAALESSVRYLAHDLGKQNI
RVNAISAGPIKTLAASGIGDFRMILKWNECNAPLKRNVGTEDVGKSGMYLLSDLASGVTG
EVHYVDAGYNIMGMGDAVSDSEGNTVLAWDLETK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgataatgaatggcaaaaaggggttaatagtcggcgttgcaaataaaatgagtatcgcc
tatggtatcgcaaaagcttgcaaggatcaaggtgcccagcttgcttttacatttttaaat
gacgctatcaaaaaacgtgtcgagccaatcgctagtgagcttggaagtgagcttatatat
gagcttgacgtgaataacaaagagcatttggacagcttggctgataagattaaagctgat
tttggcgagatagatttcgtcgtgcatgctgtggcttacgcaccaaaagaagcacttgag
ggtgagtttatcaacactacaaaagaggcttttgatatcgcgatgggaactagcgtgttt
tcacttattagccttacaagggcggttttaccagtgttaaaagatggtggctctattctt
actctaacttatcttggtgggccaaaatttgttccacattacaacgtaatgggcgtagcc
aaagccgctcttgaaagtagtgttcgctacctagctcacgaccttggcaagcaaaatatc
cgtgtaaatgccataagcgcaggacctatcaagactttagctgctagtggaatcggtgat
tttagaatgattttgaaatggaatgagtgcaacgcaccgctaaaaagaaatgtaggcacc
gaagatgtgggcaaaagtggaatgtatctgctaagcgaccttgctagcggcgtgactgga
gaggtgcattacgtggacgctggatacaatataatgggtatgggcgacgcagtaagcgac
agtgagggcaacacagtcttagcgtgggatttagaaacaaaatag

DBGET integrated database retrieval system