KEGG   Caulobacter sp. K31: Caul_0184Help
Entry
Caul_0184         CDS       T00651                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cak  Caulobacter sp. K31
Brite
KEGG Orthology (KO) [BR:cak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cak01002]
    Caul_0184
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cak04147]
    Caul_0184
   04090 CD Molecules [BR:cak04090]
    Caul_0184
Enzymes [BR:cak01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Caul_0184
Peptidases [BR:cak01002]
 Metallo Peptidases
  Family M2
   Caul_0184
Exosome [BR:cak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Caul_0184
CD molecules [BR:cak04090]
 Proteins
  Caul_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ABZ69321
UniProt: B0T386
LinkDB All DBs
Position
complement(200833..202662)
Genome map
AA seq 609 aa AA seqDB search
MKTRWLAACAAVALCAGVLPTPAARAQTTAAAATPSADQAKAFVDGAEKDLMAMGEYAAR
MAWVQATYITDDTNWLNAKIDAESNALSVKYAKEAARFDKTDVDPVTRRKLKLLKAALVL
PASSRPGAAQELADVQSRLRALYSTGKVTIDGETLTLDDLDDRLRTERDPAKIKAMWEAW
HAVAKPMAGDYPKLVQLANEGSVELGYKDTGALWRSWYDMEPDAFATKTDQLWAQVAPFY
RNLHCYVRGRLNAKYGDAVQPKTGPIRADLTGNMWAQSWGNIYDIAAPEGLAGPGYDLTQ
SLVAKGYDATKMMKTGEGFYTSLGMAPLPETFWTRSMIVRPRDREVVCHASAWDVDNDQD
LRVKMCTRVNADDFYTVHHELGHNFYQRAYAGQPYLFRGGANDGFHEAIGDFVGLSALTP
TYLKQIGVIDTAPGAEADIPYLLDMAMDKIAFLPFGLLVDKWRWQVFSGQVDPAHYNEAW
WKLRTQYQGVAPPGPRPADAFDPGAKFHVADSTPYTRYFLAQVYQFQFYRAACRQAGWKG
PLNRCSVYGDKAVGETFEKMLAMGQSKPWPEALEAFTGEKDLDASAIADYFAPLNTWLIK
QNKGQSCGW
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccgatggctggccgcctgcgcggccgtggcgctatgcgctggcgtcctgccc
acgcccgccgcccgcgcccagaccaccgccgccgccgcgacgccgagcgccgaccaggcc
aaggccttcgtcgacggggccgaaaaggacctgatggccatgggcgaatacgccgcccgc
atggcctgggtgcaagccacctacatcaccgacgacaccaactggctgaacgccaagatc
gacgccgagtccaacgccctatcggtcaagtacgccaaggaggccgcccggttcgacaag
accgacgtcgacccggtcacccgccgcaagctgaaacttctgaaggccgccctggtgctg
ccagcctccagtcggcccggcgcggcccaggaactggccgacgtgcagtcgcggctgcgg
gcgctctattccaccggcaaggtgacgatcgacggcgagaccctgacgctcgacgatctg
gacgaccggctgcgcaccgagcgcgacccggccaagatcaaggccatgtgggaggcctgg
cacgccgtggccaagccgatggccggcgactatcccaagctggtccagctggccaacgag
ggctcggtcgaactgggctacaaggacaccggggcgctatggcgctcgtggtacgacatg
gagcccgacgctttcgcgaccaagaccgaccagctgtgggcccaggtcgcgccgttctac
aggaacctgcactgctatgtgcgcggacgcctgaacgccaagtatggcgacgcggtgcag
ccgaaaacgggcccgatccgcgccgacctgaccggcaacatgtgggcccagagctggggc
aacatctacgacatcgccgcgccagagggactggccggaccgggctacgacctgacccag
tcgctggtcgccaagggctacgacgccaccaagatgatgaagaccggcgagggcttctac
acctcgctgggcatggccccgctgccggagacgttctggacgcggtcgatgatcgtccgc
ccccgcgaccgcgaggtggtctgccacgcctcggcctgggacgtcgacaacgaccaggac
cttcgggtcaagatgtgcacccgggtcaatgccgacgacttctacacggtgcaccacgag
ctggggcacaacttctaccagcgggcctatgcgggccagccctacttgttcaggggcggc
gccaatgacggtttccacgaggcgatcggcgacttcgtcggcctgtcggccctaaccccg
acctatctcaagcagatcggcgtgatcgacacggcgcccggcgcggaggccgacatcccc
tatctgctggacatggcgatggacaagatcgccttcctgccgttcggcctgctggtcgac
aagtggcgctggcaggtcttttcgggccaggtcgacccggcccactacaacgaggcctgg
tggaagctgcgcacccagtaccagggcgtcgcgccgcctggcccgcgcccggccgacgcc
ttcgaccccggggccaagttccacgtcgccgactcgacgccctacacccgctacttcctg
gcccaggtctatcagttccagttctaccgcgccgcctgccgccaggccggctggaagggt
ccgctgaaccgctgctcggtctatggcgacaaggcggtgggcgagacgttcgagaagatg
ctggccatgggccagtccaagccctggcccgaggcgctggaggccttcactggcgagaag
gacctggacgccagcgccatcgccgactatttcgcgccgctgaacacctggctgatcaag
cagaacaagggccaatcctgcggctggtag

DBGET integrated database retrieval system