KEGG   Caulobacter sp. K31: Caul_3660Help
Entry
Caul_3660         CDS       T00651                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cak  Caulobacter sp. K31
Pathway
cak00473  D-Alanine metabolism
cak00550  Peptidoglycan biosynthesis
cak01100  Metabolic pathways
cak01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Caul_3660
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Caul_3660
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Caul_3660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cak01011]
    Caul_3660
Enzymes [BR:cak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Caul_3660
Peptidoglycan biosynthesis and degradation proteins [BR:cak01011]
 Precursor biosynthesis
  Amino acid ligase
   Caul_3660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ABZ72787
UniProt: B0T824
LinkDB All DBs
Position
complement(3950014..3950982)
Genome map
AA seq 322 aa AA seqDB search
MTPANPKPLANHHIAVLLGGPSAEREVSLVTGAAYAAALERLGARVSRVDPGKDVAQVLT
ALAPDLVFNGLHGRWGEDGCVQGVLETLGLAYTHSGVLASALAMDKAKSKAVLAAAGIPV
PGGGLFDRHDVAQGHVMPPPYVVKPNAEGSSVGVSLVFEGANGPPRQLAAPDWAFGEQVM
VEPYIPGLELAVAVVGESNGPRALAVTEIRSSTGFYDYDAKYSQGGSIHVLPAPIPDAVR
DRALHLAKLGHTALGCQGVTRSDFRYDDINDLLVLLEVNTQPGMTPTSLVPEQADHAGVS
FDRLVFWIVEDAYARRFAGGIA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagccaaccccaagcccctcgccaaccatcacatcgccgtcctgctcggcggt
ccttccgccgagcgtgaggtcagcttggtcaccggcgcggcctatgccgccgccctcgag
cgcctcggcgcccgcgtcagccgggtcgaccctgggaaggacgtcgcccaggtcctgacc
gctctcgcgcccgacctggtgttcaacggcctgcatggccgctggggcgaggacggctgc
gtgcagggcgtgctggagaccctggggctggcctacacccattccggcgtcttggcctcg
gccctggcgatggacaaggccaagtccaaggccgtgctggcggcggcggggatccccgtg
cccggcggcgggctgttcgaccgccacgacgtcgctcagggccacgtgatgccgccgccc
tatgtggtcaagcccaacgccgagggctcttcggtcggggtgtctctggtcttcgaaggg
gcgaacggcccgccgcgccaattggccgcgcccgactgggctttcggcgagcaggtgatg
gtcgagccctatatccccgggctggagctggcggtcgcggtggtgggtgagtcaaatggt
cccagggccttggcggtaaccgaaattcgctcgtccacaggtttttacgattacgacgcc
aagtactcgcagggcggctcgattcacgtcctgcccgccccgattccggacgctgtaagg
gatcgcgccctgcatctcgccaagcttggccatacagctcttggttgccagggtgtgact
cgatcggacttccgttatgacgacattaacgaccttctggtgttgctagaggtcaatacg
cagcctggcatgacacccacttcgctcgtccccgagcaggcggaccacgccggcgtctcg
tttgaccgtctagtgttttggatcgtggaggacgcttatgcccgcaggtttgcggggggg
atcgcgtaa

DBGET integrated database retrieval system