KEGG   Caulobacter sp. K31: Caul_4837Help
Entry
Caul_4837         CDS       T00651                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cak  Caulobacter sp. K31
Pathway
cak00020  Citrate cycle (TCA cycle)
cak00190  Oxidative phosphorylation
cak00650  Butanoate metabolism
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01120  Microbial metabolism in diverse environments
cak01130  Biosynthesis of antibiotics
cak01200  Carbon metabolism
Module
cak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cak_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caul_4837
   00650 Butanoate metabolism
    Caul_4837
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Caul_4837
Enzymes [BR:cak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Caul_4837
    1.3.5.4  fumarate reductase (quinol)
     Caul_4837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: ABZ73957
UniProt: B0T473
LinkDB All DBs
Position
complement(5235311..5236093)
Genome map
AA seq 260 aa AA seqDB search
MVQLTLPKNSTVQNGKTWPAPAGAKNTRSFKVYRYDPEDGRNPRWDTYEVDLDACGPMVL
DALLYIKNTIDPTLAFRRSCREGVCGSCAMNIGGRNTLACTHGHADTPGKAVQISPLPSQ
PVVKDLIPDLTLFYAQYASIEPWLHTVTPEPQTEWKQSPEDRSKLDGLYECILCACCSTS
CPSYWWNGDKYLGPATLLHAYRWLIDSRDEATGDRLDNLEDPFKLYRCHTIMNCAQVCPK
GLNPAKAIAEIKKMLVERVV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggttcagctcaccctccccaagaactccaccgtccagaacggcaagacctggcccgcc
ccggccggcgccaagaacacccggtcgttcaaggtctatcgctacgatccggaagacggc
cgcaacccgcgctgggacacctacgaggtggatctcgacgcctgcggcccgatggtcctg
gacgcgctgctctacatcaagaacaccatcgacccgacgctggccttccgccgctcgtgc
cgtgaaggggtctgcggctcctgcgccatgaacatcggcggtcgcaacaccctggcctgc
acccacggccacgccgacacccccggcaaggccgtgcagatcagcccgctgcccagccag
ccggtggtcaaggacctgatccccgacctgacgctgttctacgcccagtacgcctcgatc
gagccctggctgcacaccgtcacgcccgagccgcagaccgagtggaagcaatcgccggaa
gaccgttccaagctggacggcctctacgagtgcatcctctgcgcctgctgctcgacctcg
tgccccagctactggtggaacggcgacaagtacctgggtccggccaccctgctgcacgcc
tatcgctggctgatcgacagtcgcgacgaagccacgggcgaccgcctcgacaacctcgag
gacccgttcaagctctatcgctgccacacgatcatgaactgcgcccaggtctgccccaag
ggcctgaacccggccaaggcgatcgccgagatcaagaagatgctggtcgagcgggtcgtc
tag

DBGET integrated database retrieval system