KEGG   Candida albicans: CAALFM_C104750WAHelp
Entry
CAALFM_C104750WA  CDS       T00189                                 

Gene name
IFE1, CaO19.769
Definition
(RefSeq) putative dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cal  Candida albicans
Pathway
cal00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CAALFM_C104750WA (IFE1)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CAALFM_C104750WA (IFE1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CAALFM_C104750WA (IFE1)
    1.1.1.-  
     CAALFM_C104750WA (IFE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc
Motif
Other DBs
NCBI-GeneID: 3644778
NCBI-ProteinID: XP_713579
UniProt: A0A1D8PDC5
LinkDB All DBs
Position
1
AA seq 394 aa AA seqDB search
MKAIVYHDRGDIRYDPNFPDPQIIRSDDVKIKVHYCGICGTDLKEYSDGPIFFPPKGELN
EISQMESIQVMGHEISGEVIAIGDDVTNVKVGDKVVVEVTGTCLDRHRYQDSKNGDSPKP
NCPSCVSGNYNACDYLALIGCGFANGGCAEYLVVANSKVIAFDQDKIPMDIAALIQPIAV
SWHAVKVSNFKPGSNALILGGGPIGLTTIFALKGNQVSQIVLSEPALARRQLAEKLGVIT
YDPTGKSIEQCVEDLKKLSPGGYGYEYSYDCSGVKATFETGLKTLKIRGCATNVAIWAHK
SIPLYPMEITLSEKMLTGSICFVKKDFEESIKAIENGLISIDELKMLITSKIHLQDGIEK
GFLELINHKEKHIKILFSPKSEYLLSNGVNDSNK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaattgtataccacgacagaggagatattagatacgaccccaatttccctgat
ccacaaatcattcgactggatgatgtcaaaatcaaagttcattattgcgggatttgcggt
actgatttaaaagaatatagtgatgggccgatttttttcccaccgaaaggtgaattgaat
gaaatttctcaaatggaatcaattcaagtcatgggtcatgaaattagtggtgaagtaatt
gctattggagatgatgtaaccaatgttaaagtgggtgataaagttgttgttgaagttaca
ggtacctgtttagatagacatcgttaccaagattctaaaaatggcgatctgcctaaacca
aattgtccaagctgtgtttcgggtaactataatgcttgtgattatcttgctttaattggt
tgtggatttgctaatggtggatgtgcagaatatttagttgttgctaatctgaaagttatt
gcatttgatcaagataaaatccctatggatatagccgcgttaattcagccaatagctgtt
agttggcatgctgttaaagtatcaaattttaaacccggttctaatgcattaattttaggt
ggtggtcccattggattaacaacaatttttgctttgaaaggtaatcaagtttctcaaatt
gttctaagtgaaccagcattagcaagacgtcaattggcagagaaattaggagttattact
tatgaccctactggtaaatcaattgaacaatgtgttgaagatttaaaaaaattatccccc
ggaggttatggatatgaatattcatatgattgttctggagttaaagcaacttttgaaact
ggattgaaaactttgaaaattcgtggatgtgcaacaaatgttgccatttgggctcataaa
tcaattccattatatcctatggaaattaccctttcagaaaaaatgttaactggatcaatt
tgttttgttaaaaaagattttgaagaatcaattaaagcaattgaaaatggtttaatatcg
attgatgaattgaaaatgttgattactctgaaaattcatttacaagatggaattgaaaaa
gggtttttggaattaattaatcacaaggaaaaacatattaaaatattgttttctccgaaa
agtgaatatttactatccaatggagtaaatgattccaataaataa

DBGET integrated database retrieval system