KEGG   Candida albicans: CAALFM_C110290WAHelp
Entry
CAALFM_C110290WA  CDS       T00189                                 

Gene name
GCA1, CaO19.4899
Definition
(RefSeq) Gca1p
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cal  Candida albicans
Pathway
cal00052  Galactose metabolism
cal00500  Starch and sucrose metabolism
cal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CAALFM_C110290WA (GCA1)
   00500 Starch and sucrose metabolism
    CAALFM_C110290WA (GCA1)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CAALFM_C110290WA (GCA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7 DUF5110
Motif
Other DBs
NCBI-GeneID: 3634903
NCBI-ProteinID: XP_723581
UniProt: O74254
LinkDB All DBs
Position
1
AA seq 946 aa AA seqDB search
MKLLSKVFVTALGLTSIVNAAPTSSSSAEEAQKTVPVELSIGVKQLPNIHNDSAVDANAV
AKGYSLVNVSLTARGLTGILKLKEATNIYGYDFEYLNLSVEYQSDTRLNVHIEPTDLTDV
FVLPEELVVKPKLEGDAKTFNFENSDLVFEYDEEDFGFEVLRSSTREVLFSTKGNPLVFS
NQFIQFNTTLPKGHSITGLGESIHGSLNEPGVVKTLYANDIADPIDGNIYGVHPVYYDQR
YNTNTTHAVYWRTSAIQEVVVGETSLTWRALSGVIDLYFFSGPDPKDVIQQYVSEIGLPA
MQPYWALGYHQCRWGYDTVESLETVVENFKKFDIPLETIWSDIDYMDGYKDFTNDPYRFP
TDKFRKFLDDLHNNSQHYVPIFDAAIYVPNPNNATDNDYEPFHLGNESDVFLKNPDGSLY
IGAVWPGYTVFPDFLANNTQEYWNKMFKDWYERIPFDGIWTDMNEVSSFCVGSCGTGRYF
DNPVHPPFEVGYSGSDYPLGFDKSNASEWKSISEAAAATKTTTTTSSSTSTSIDGKNTLA
PGKGNINYPPYAINNNQGDHDLATHAISPNATHADGTVEYDIHNIYGLIQERAIYEALLE
IHPNKRPFIIGRSSFAGSGKYMGHWGGDNYADYYMMYFSIPQALSMGLSGIPFFGVDACG
FNGNTDMELCSRWMQLASFFPFYRNHNVLGAIPQEPYVWEGVMNATKTSINVRYSLLPYY
YTLLHESHVTGIPIMRAFNWQFPYSKELAGVDTQFFVGDALLVTPVLEPGVNHTKGVFPG
ENAVYYDFYTHKKQKFTAGKNETLAAPLGHIPLHIKGGNIIPTQEPGYTTTESRKNPFGL
LVALDAEGTASGKLYLDDGESVDVEEALYVDFVASKNKLVASVFGEYEVRQPLANVTILG
VDSEPKKVLFNNETVSHNYENGAVYLTDLEKFTKEGAFAEEFSIQW
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttatccaaggtatttgttactgctttgggtcttacttcaattgtcaatgcc
gctccaacaagtagtagtagtgcagaagaagcccaaaaaactgttcctgttgaacttagt
atcggtgtcaaacaacttcctaacattcacaatgattcagctgtcgatgctaatgctgtt
gctaaaggttattctttggtaaatgtttctttaactgctagaggtttaactggtattttg
aaacttaaagaagctacaaacatttatggttacgactttgaatacttgaatttgtcagtt
gaataccaaagtgatacaagattaaatgttcatatagaacctactgatttgactgatgtt
tttgttttgccagaagaacttgttgttaaaccaaaacttgaaggtgatgctaaaactttt
aattttgaaaactccgacttggtttttgaatatgatgaagaagattttggatttgaagtt
ttaagaagctctactcgtgaagtattgttctccactaaaggtaatccattggttttctcc
aatcaattcattcaattcaatactactttaccaaaaggtcactcaattactggattaggc
gaatccattcatggatctttgaatgaaccaggtgttgtcaaaacattgtatgccaatgat
attgctgatccaattgacggtaacatttatggtgtacatccagtgtactacgaccaaaga
tataacacaaacactacacatgctgtttattggagaacttcagctattcaagaagttgtc
gttggtgagacttctctcacatggcgtgctctttctggtgtcattgatctttatttcttt
agtggtccagatccaaaagatgttatccaacaatatgtttctgaaattggtttacctgct
atgcaaccatactgggcattgggttaccatcaatgtagatggggttacgacactgttgaa
tcacttgaaactgttgttgaaaatttcaaaaaatttgatattcctttggaaaccatttgg
tcagatattgattacatggatggatacaaagatttcaccaatgatccatacagattccca
acagataaatttagaaaatttttagatgatcttcacaataacagtcaacattatgttcct
atatttgatgctgcaatttatgttcctaacccaaacaatgccactgataatgattatgaa
ccattccacttgggtaatgaatcagacgtgttcttgaaaaatccagatggatcattatat
attggtgcagtatggccaggatacactgtattcccagactttttagccaacaatactcaa
gaatattggaacaaaatgtttaaagattggtatgagagaattccatttgatggtatttgg
acagatatgaatgaagtcagttccttctgtgttggttcatgtggtaccggtagatatttc
gataacccagttcatccaccatttgaagttggatattctggttctgattatccattaggt
tttgataaatcgaatgcatctgaatggaaatcaatttctgaagcagcagcagctactaaa
acaaccaccacaacatcatcttcaacttcgacatcaattgatggtaagaacactttagct
ccaggtaaaggtaatatcaactatccaccatacgcaatcaataacaaccaaggtgatcac
gaccttgccacacatgcaatttcaccaaatgctactcatgccgatgggactgttgaatac
gatattcataatatatatggtctcattcaagaacgtgccatttacgaagcattattggaa
attcatcctaacaagagaccatttattattggacgttcatcatttgctggatctggtaaa
tacatgggtcattggggaggtgataactatgctgactattatatgatgtacttttctatt
cctcaagctttatcaatgggtctttctggtatcccattctttggtgtggatgcatgtggg
ttcaatggtaacactgatatggagttatgttctagatggatgcaattggcttcattcttc
ccattctacagaaaccataatgttttgggtgctattccacaagagccatatgtctgggaa
ggtgttatgaacgcaactaagacatccattaatgtcagatattctttgttgccatactat
tacactttgttacacgaatcacacgttactggtattccaattatgcgtgctttcaactgg
caattcccttacagcaaagaattggccggcgttgatactcaatttttcgttggtgatgca
ttattggttacaccagttttagaaccaggtgtcaaccatactaaaggtgttttcccaggt
gagaatgctgtgtactatgatttctacactcataagaaacaaaaattcactgctggcaag
aacgaaactttggctgctcctttgggtcacattccattacacattaaaggtggtaacatc
attccaactcaagaaccaggttatactaccactgagtcaagaaagaatccatttggattg
ttggttgccttggatgctgaaggtactgcttctggtaaattgtatctcgatgatggtgaa
tccgtagatgttgaagaagcattatatgttgactttgttgcatccaagaataaattggtg
gcatctgttttcggtgaatatgaagttcgtcaaccattggccaatgttacaattttggga
gttgattctgaacctaagaaggttttgtttaacaacgaaacagtaagccacaactacgaa
aatggtgctgtgtatcttactgatttagaaaaattcaccaaagaaggtgcctttgctgaa
gaatttagtattcaatggtaa

DBGET integrated database retrieval system