KEGG   Candida albicans: CAALFM_C205890CAHelp
Entry
CAALFM_C205890CA  CDS       T00189                                 

Gene name
IDP1, CaO19.5211
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cal  Candida albicans
Pathway
cal00020  Citrate cycle (TCA cycle)
cal00480  Glutathione metabolism
cal01100  Metabolic pathways
cal01110  Biosynthesis of secondary metabolites
cal01130  Biosynthesis of antibiotics
cal01200  Carbon metabolism
cal01210  2-Oxocarboxylic acid metabolism
cal01230  Biosynthesis of amino acids
cal04146  Peroxisome
Module
cal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cal_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAALFM_C205890CA (IDP1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CAALFM_C205890CA (IDP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CAALFM_C205890CA (IDP1)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CAALFM_C205890CA (IDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 3647474
NCBI-ProteinID: XP_710919
UniProt: A0A1D8PHH7
LinkDB All DBs
Position
2
AA seq 433 aa AA seqDB search
MIRTTTTRAINRTAMLQNHIRGFSSTASILDKIKVKNPIVELDGDEMTRIIWQKIKDQLI
LPYLDVNLKYYDLGIESRDATNDQITIDAANAIKEHGVGVKCATITPDEARVKEFNLKKM
WLSPNGTIRNILGGTVFRESIIIPCIPRLIPGWKEPIVIGRHAFGDQYKATDLVINEPGK
LELRFTPENGGETQTHKVYDYTGPGVGLAMYNTDESISGFARASFNMALSKNLPLYMSTK
NTILKKYDGRFKDIFQDIYENEYASEFEKKGLWYEHRLIDDMVAQMIKSKGGFVMALKNY
DGDVQSDIVAQGFGSLGLMTSALMTPDGKAYEAEAAHGTVTRHYRQHQQGKETSTNSIAS
IFAWTRGLAQRGRLDETPEVVDFADKLEKATIDTVEVDRIMTKDLALAMGKTDRSAYVTT
TEFLDAVADRLKK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattagaacaaccactaccagagccattaaccgcacagctatgttgcaaaaccacatt
cgtgggttttccagtactgcttcaattttagataagatcaaagtgaaaaaccccattgtc
gaattggatggtgatgaaatgacccgtattatttggcaaaaaattaaagatcaattgatc
ttgccatatttggatgttaatttgaaatattacgatttaggaatcgagtctcgtgatgcc
accaatgaccaaatcaccattgatgccgcaaatgcaattaaagaacatggtgttggtgtc
aaatgtgcaacaattacccccgatgaagctagagtaaaagaattcaatttgaagaaaatg
tggctttctccaaatggtaccattagaaacattcttggtggtactgtcttcagggaatca
attattattccatgtattccaagattgattccgggatggaaagaaccaattgtcataggt
agacatgcttttggagatcaatacaaagctactgatttagttattaatgaacccggtaaa
ttggaattgagattcaccccagaaaatggtggtgaaacccaaactcataaggtctacgac
tacactggtccaggtgtcggattggccatgtacaacaccgacgaatctatcagtgggttt
gctcgtgcctccttcaacatggcgttatccaagaacttgccattgtacatgtcaaccaaa
aacactattttgaaaaaatacgatggaagatttaaagacatcttccaagacatttacgaa
aatgaatacgccagtgaatttgaaaagaaggggttgtggtatgaacacagattaattgat
gatatggttgctcaaatgatcaaatccaaaggtggattcgtcatggcattaaagaattac
gatggtgatgttcaatcagatattgttgctcaaggttttggatcattaggtttaatgaca
tctgcattgatgactccagatggaaaggcatacgaagctgaagctgcccacggtaccgtc
accagacactacagacagcaccaacaaggtaaagaaacctctacgaactccattgcatct
atatttgcctggacaagaggtttggcccaaagaggaagattagatgagacaccagaagtc
gttgactttgctgacaaacttgaaaaggctactatcgacactgttgaagttgatcgtatc
atgaccaaagatttagccttggccatgggcaaaaccgacagatctgcatatgttaccact
actgaatttttggatgctgttgctgatagattgaagaaataa

DBGET integrated database retrieval system