KEGG   Candida albicans: CAALFM_C210250CAHelp
Entry
CAALFM_C210250CA  CDS       T00189                                 

Gene name
SET2, CaO19.1755
Definition
(RefSeq) histone methyltransferase
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cal  Candida albicans
Pathway
cal00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CAALFM_C210250CA (SET2)
Enzymes [BR:cal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CAALFM_C210250CA (SET2)
Chromosome and associated proteins [BR:cal03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CAALFM_C210250CA (SET2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW Med26
Motif
Other DBs
NCBI-GeneID: 3643923
NCBI-ProteinID: XP_714401
UniProt: Q59XV0
LinkDB All DBs
Position
2
AA seq 844 aa AA seqDB search
MSNNNFQESSNNTSSPSKRSTPMLFLDAENKTQEALTTFELLNACTYQNKYVGSANVTTT
ATTSTKTSNSTSTKSHQQQHRRKLEYMTCDCEEEWDSELQMNLACGPDSNCINRITCVEC
VNRNCLCGDDCQNQRFQNRQYSKVKVIQTELKGYGLIAEQDIEENQFIYEYIGEVIDEIS
FRQRMIEYDLRHLKHFYFMMLSNDSFIDATEKGSLGRFINHSCNPNAFVDKWHVGDRLRM
GIFAKRKISRGEEITFDYNVDRYGAQSQPCYCGEPNCIKFMGGKTQTDAALLLPQMIAEA
LGVTPRQEKAWLKENKSIRNQQQNDESNINEEFVNSIEIEPIENQDGVTKVMSALMKTQH
PLIIKKLIERIFLSNDQDDINVMFVRFHGYKTISTILQDLLVAKNSGKESETTDNNDIDN
STGDDDQDKDELIIKILKILVSWPAVTKNKIASANLEEVVKDIQTNNENSNNNDEINQLC
TSLLDRWSKLEMAYRIPKQESVPTNNAAAAATTTATATGTTTSASPFERISSHTPEVGGT
NTPSSTSQQQQQQNSRDAGLPENWRSAFDKNTGGYYYYNLVTKETTWERPLGSLPLGPKP
PSGPGLKGRINKYNEIDLAKREELRIQKEKEMKFIEMQNRDRKLKELIEMSKKSMNNIGG
SSGTTITAATINGLSDNGGNNNGNITGIYGDDKHSKHHHHHHDKHLKNGPRNTSTSSSSG
NNVEKIWKRIFAKYIPNIIKKYESEIGRDNVKGCAKELVNILTQSEIKHGNSLPSSSSSN
GYSMELSDKKLKKIKEYSHGYMDKFLIKFNNSKKHKSTMGSKGSDNHKRKHNGDGDNGVK
RSKV
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataacaactttcaagagagttctaataacactagcctgccttctaaacgatcg
acaccaatgttgtttcttgatgccgaaaacaaaactcaagaagcattaacaacttttgaa
ttactaaatgcatgtacatatcaaaacaaatatgttggatcggccaacgtcaccactact
gccactaccagtactaaaacatctaactcaaccctgactaaatctcatcaacaacaacat
cgtcggaaacttgaatatatgacatgtgattgtgaagaggaatgggatagtgaattacaa
atgaatttagcgtgtggacccgattctaattgtattaatcgaattacttgtgttgaatgt
gttaataggaattgtttatgtggggatgattgtcaaaatcaacgatttcaaaaccgtcaa
tatagtaaagtcaaagttattcaaacggaattaaaaggttatggattaattgctgaacaa
gatattgaagaaaatcaatttatttatgaatatattggtgaagttatagatgaaattagt
ttccgtcaacgaatgattgaatatgatttacgacatttaaaacatttttattttatgatg
ttaagtaatgattcatttattgatgccacggaaaaagggtcattaggtcgatttattaat
cattcttgtaatcctaatgcatttgttgataaatggcatgttggtgatcgattaagaatg
gggattttcgctaaaaggaaaatttcccgtggtgaagaaattacatttgattataatgtt
gatagatatggagctcaatctcaaccatgttattgtggtgaaccaaattgtataaaattc
atgggtgggaaaactcaaactgatgctgcattattattaccacaaatgattgctgaagca
ttaggagtaacaccaagacaggaaaaagcttggcttaaagaaaataaatcaattagaaat
caacaacaaaatgatgaatcaaatataaatgaagaatttgttaatagtattgaaattgaa
ccaattgaaaatcaagatggggtgactaaagtaatgtcagcattgatgaaaactcaacat
cctttaattattaaaaaattgattgaaagaatatttcttagtaatgatcaagatgatatt
aatgttatgtttgttagattccatggatataagacaatatcaacaattttacaagattta
ttagtggccaagaatagtggtaaagaatcagaaacaactgataacaacgatatcgacaac
tctactggagatgacgatcaagataaagatgagttgattattaagattttgaaaatattg
gtgagttggccagcagttactaagaataaaatagcttcagctaatttagaagaagttgtt
aaagatattcaaaccaataatgaaaatagtaataataatgatgaaattaatcaattatgc
actagtttattagatagatggtcaaaattagaaatggcttatcgtattcctaaacaagag
agtgtacctaccaacaatgctgctgctgctgctacaacaactgcaactgccaccggcacc
actacttcagcatctccatttgaaagaatatcatctcatacaccagaagtaggtggtacc
aatacaccatcatcaacctcacaacaacaacaacaacaaaattcacgagatgcgggatta
ccagaaaattggcgtagtgcatttgataaaaacactggtggatattattattataatctt
gttactaaagaaactacctgggaaagacctttgggttcattaccattaggaccaaaacca
ccaagtggaccaggcttaaaaggtcgaattaataaatataatgaaattgatttagctaaa
agagaagaattaagaattcaaaaggaaaaagaaatgaaatttattgaaatgcaaaatcga
gatcgtaaacttaaagaattgattgaaatgagtaaaaaatcaatgaataacattggtggt
agtagtggtactaccattactgctgctactattaatggtttatctgataatggtggaaat
aacaatgggaatattactggtatttatggagatgataaacactcaaagcatcatcatcat
catcatgataagcatttgaaaaatggtcctagaaataccagcaccagcagtagtagtggt
aataatgttgagaaaatttggaaacgaatatttgctaaatatattcctaacattattaaa
aaatatgaatcagaaattggtcgtgataatgttaaaggatgtgccaaagaattagttaat
attttaacacaaagtgaaatcaagcatggtaatagtctaccctcatcatcttcttcgaat
ggttatagtatggaattgagtgataaaaaattgaaaaaaataaaagaatacagtcatgga
tatatggacaaatttttaattaaatttaataattccaaaaaacacaaatctacaatgggg
agtaagggaagtgataatcataaacgaaagcataatggtgatggagataatggagtaaaa
cgtagtaaagtatag

DBGET integrated database retrieval system