KEGG   Candida albicans: CAALFM_C300640WAHelp
Entry
CAALFM_C300640WA  CDS       T00189                                 

Gene name
CaO19.5393
Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cal  Candida albicans
Pathway
cal00250  Alanine, aspartate and glutamate metabolism
cal00410  beta-Alanine metabolism
cal00430  Taurine and hypotaurine metabolism
cal00650  Butanoate metabolism
cal01100  Metabolic pathways
cal01110  Biosynthesis of secondary metabolites
Module
cal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CAALFM_C300640WA (CaO19.5393)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CAALFM_C300640WA (CaO19.5393)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CAALFM_C300640WA (CaO19.5393)
   00430 Taurine and hypotaurine metabolism
    CAALFM_C300640WA (CaO19.5393)
Enzymes [BR:cal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CAALFM_C300640WA (CaO19.5393)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 3640574
NCBI-ProteinID: XP_717768
UniProt: Q5A7S3
LinkDB All DBs
Position
3
AA seq 494 aa AA seqDB search
MTIESNLESNRSEELDNLLTQLKPRLLAYIDEADPKSSNYKPESLGTFHEPKFLKQQFID
PDNDLDKPCSEEELFETIDKVLKFSVNTWNPGFLDKLYASNNPIGVISDILLSILNTNSH
VYTVSPVLSVLENYIGKKYAQLFFHNETCGGLTFSGGSWSNITSLQIARSLKYPDTKVKG
NGNYKFALYTSKHCHYSVEKGAILLGLGSENVFKVDVDENGVMDVDSLKQVIEKTKKEGY
TPLYINATAGTTVFGSYDPFLEISKVAKEHNIHFHIDGSWGGNVIFSPKYRDRLAGSEYA
DSITVNPHKMLGIPNTCSFLLLPQVANFQTAMSLKAPYLFHGRESGSDENYDLADGTMGC
GRRSDAFKFYLGWLYYGEQGFAKRVEHAYSIMEYFVQSIRSNPNFEIVGPQSPQCLQVCF
YYHPATVNKSNTEITRYVSRKLHKLGKYLVDFSPNPVDDTQGEFFRVVFNSPILSDKIVD
ELIASIISVGKELE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaatcaaatttagaatccaatagatctgaagaattagataatttattaacc
caattaaaacctcggttacttgcttatattgatgaagctgatcctaaatcatccaattat
aaaccagaatccttgggtactttccatgaaccaaaatttttaaagcaacaatttattgat
cccgataatgatttagataaaccatgcagtgaagaagaattatttgaaactattgataaa
gtattgaaattttcagtaaatacttggaaccctggatttttagataaactatatgcctca
aataatcctattggggtgatttctgatatattattgagtattttaaataccaattctcat
gtttatactgtttcaccagtgttatcagtgcttgaaaattatattggtaaaaaatatgct
caattatttttccataatgaaacttgtggggggttaacttttagtggtgggtcttggtcc
aatattaccagtttgcaaattgccagatcgttgaaatatcctgatactaaagtcaagggc
aatggtaattacaagtttgccttgtatactagtaaacattgtcattattctgttgaaaaa
ggggctatcttattgggattgggatcagaaaatgtatttaaagttgatgttgatgaaaat
ggtgtaatggatgttgattctttgaaacaagtgattgaaaaaaccaagaaagaaggctat
accccattatatattaatgccactgccggtactactgtgtttgggtcctatgatccattc
ttggaaattagtaaagttgccaaagaacacaatatccatttccacattgatggatcctgg
ggtggaaatgttattttttcaccaaaatatagagatagattagccggaagcgaatatgct
gattccattactgttaatccccataaaatgttgggtattccaaacacttgttcatttttg
ttgttgcctcaagtggccaatttccaaactgccatgtcattgaaagctccttatttattc
catggacgtgaactgggttctgatgaaaattatgatcttgctgatggtacaatggggtgt
ggtagaagaagtgatgccttcaaattttacttgggttggttatattatggtgaacaagga
ttcgccaaacgtgttgaacatgcttattctattatggaatattttgttcaatcaataaga
tcaaatcctaatttcgaaattgttggtcctcaatcacctcaatgtcttcaagtttgtttc
tattatcatccagcaactgtgaacaaatcaaatactgaaataacaagatatgtctcgaga
aaattacataaattagggaaatatttagttgattttagtcctaatcctgttgatgatact
caaggtgaatttttccgtgtggtgttcaattctcctattttgagtgataaaattgttgac
gaattgatcgcttcaataattagtgtgggcaaagaattagagtaa

DBGET integrated database retrieval system