KEGG   Candida albicans: CAALFM_C301320CAHelp
Entry
CAALFM_C301320CA  CDS       T00189                                 

Gene name
SGA1, CaO19.1719
Definition
(RefSeq) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cal  Candida albicans
Pathway
cal00500  Starch and sucrose metabolism
cal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CAALFM_C301320CA (SGA1)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CAALFM_C301320CA (SGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 3636652
NCBI-ProteinID: XP_721790
UniProt: Q5AJ73
LinkDB All DBs
Position
3
AA seq 564 aa AA seqDB search
MRLLSFNLFIIFIINLGYVNSFLIPTKGLNLFHLQQQQQQSIFSTNLKQALTTPPPNSFY
DWLVFQKQVCLKSILNNIGGDFTIDNKDLLPGVVIASPSTSNPDYYYQWTRDSAIIINIL
IDHLSQTPLHLINKNSTSSLVHIIESYIFNTQILQQLPNLSGNVDNLENLGEPKFHVNLT
AFNESWGRPQRDGPGLRSIAIMNYLSLLNNTQHQPSFSNLTMNNTSKIYHDIIKPDLKYS
IEFWQFEGFDLWEEIKGIHFFTSLVQLKSLTMGLKFAQFYNDSFEFRLDIMNSIELLTKY
IELESGFINNEDSDGDEDNEQQLLSKSYIISSPKLFYTKSRSGLDIASILAVLYTHNNNN
ANDDDDNDFPFDVDNGLVLTTLRYLIQDMTLRYPINFQDNFQGVALGRYPEDIYDGYGKS
EGNPWFISTATASELIYRLIYKLKSNNQAIIIDQKNIEFYKEFIHSVSATEISNNELKFE
AHINGHPMMIINKDDKLYDELINKLFHYADGFLKVVQKHVDNNGDMNEQFNKYIGFMQGA
EKLTWSYGAVFTAINWRNKTLSIL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgagattgttgtcattcaatttatttatcatctttatcattaatctaggttatgttaat
tcatttttaataccaacaaaaggattaaacctttttcatctacagcaacagcaacagcaa
tcaatattctcaactaatcttaaacaagctctaaccacaccaccaccaaattcattttat
gattggttagttttccaaaaacaagtttgtttgaaatcaatactcaataatattggtgga
gatttcactattgataacaaagatttattgccaggggtggttatagcatcaccgtcaact
tcaaatcctgattattactatcaatggacaagggattctgctattataataaatatcttg
attgatcatttatcccaaactccattgcatttgataaacaaaaattcaacttcaagtttg
gttcatattattgaatcatacatttttaatacccaaattttacagcaattacccaattta
tctggtaatgttgacaacttggaaaatttaggtgaaccaaaatttcatgtcaatttgact
gcatttaatgaatcttggggtcgtcctcaacgagatggaccaggattaagatcaattgcc
ataatgaattatctaagtttattgaacaatacccagcatcaaccatcattttctaatttg
acaatgaataatactctgaaaatatatcatgatattataaaaccagatttaaaatattca
attgaattttggcaatttgaaggatttgatttatgggaagaaatcaagggtattcatttt
ttcactagtttggtccagttaaaaagtttaactatgggattaaaatttgcacaattttat
aatgattcatttgaatttagacttgatataatgaatctgattgaattattgactaaatat
attgaattggaatcagggtttatcaataacgaagatagtgatggcgatgaagacaacgaa
caacagttgttatcaaaatcatatataatttcatccccgaaattgttctataccaaatca
agaagtggattagatattgcttcaattcttgctgtattgtacacccacaataataacaat
gctaatgatgatgatgataacgatttcccatttgatgtagataatggattggtattaaca
acattaagataccttattcaagacatgacattaagatatccaataaatttccaagataat
tttcaaggagtagcattaggtcgataccctgaagatatttatgatggatatggtaaatca
gaaggaaatccttggtttataagtactgcaactgcaagtgaattgatttatcgattaatt
tataaattgaaactgaataatcaggcgattataattgatcaaaaaaatatcgagttttat
aaagaatttattcacagtgtcagtgcaacagaaatttccaataatgaactaaaatttgaa
gcccatattaatggacatccaatgatgatcatcaataaagatgataaattatatgatgaa
ttaatcaataaattattccattatgctgatgggtttttaaaagttgttcaaaaacatgtt
gataataatggtgatatgaatgaacaatttaataaatatattggattcatgcaaggcgca
gaaaaattgacttggagttatggagctgtatttacagcaattaattggcgtaataaaact
ttatcaattttataa

DBGET integrated database retrieval system