KEGG   Candida albicans: CAALFM_C406610CAHelp
Entry
CAALFM_C406610CA  CDS       T00189                                 

Gene name
SDH12, CaO19.2871
Definition
(RefSeq) Sdh12p
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cal  Candida albicans
Pathway
cal00020  Citrate cycle (TCA cycle)
cal00190  Oxidative phosphorylation
cal01100  Metabolic pathways
cal01110  Biosynthesis of secondary metabolites
cal01130  Biosynthesis of antibiotics
cal01200  Carbon metabolism
Module
cal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cal_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAALFM_C406610CA (SDH12)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CAALFM_C406610CA (SDH12)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CAALFM_C406610CA (SDH12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 3642775
NCBI-ProteinID: XP_715528
UniProt: Q5A1E8
LinkDB All DBs
Position
4
AA seq 641 aa AA seqDB search
MLTSLRNQVKSSAVTKRLLSSSSVRSQVIGSNVKGQDFNAAKYMSQKYHVVDHEYDCVVV
GAGGAGLRAAFGLVSEGFKTACVSKLFPTRSHTVAAQGGINAALGNMHADDWHWHFYDTV
KGSDWLGDQDAIHYMTKEAPASIYELEHYGVPFSRNDEGRIYQRAFGGQSKEFGKGGQAY
RTCAVADRTGHALLHSLYGQSLRHDCHFFIEFFAMDLMMKDGACIGIIAYNEEDGTLHRF
FANRTIMATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDLEFVQFHPSGIYGSGCLI
TEGARGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRAITMEINEGRGVGPEKDHMYLQ
LSHIPAPVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTNWKGEVLKKSAD
GNDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVAHTIRDNLQPGTPIPDHAK
DIGYESIANLDKLRNANGSKPTADIRLEMQKTMQKGCAVFRTQETLDQCVEHIGEVDKSF
EDVKTTDRSMIWNSDLVETLELQNLLTCATQTAASAAARTESRGAHSRDDFPDRDDVNWR
KHTLSYQETVGGPVRLDYRDVVKTTLDENDCKPVPPAKRVY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgttgacttcattgcgtaatcaagtgaaaagttcagcagtgacaaagagattgttatct
tcatcttctgttagatcccaagttattggatcaaatgtcaaaggtcaagatttcaatgct
gccaagtatatgagtcaaaaataccacgtcgttgaccacgaatatgactgtgttgtcgtt
ggtgccggtggtgctggtttgagagcagctttcggtttagtctctgaaggtttcaaaacc
gcctgtgtttctaaattgttccctaccagatcacatactgttgccgcacaaggtggtatt
aacgctgctttaggtaacatgcacgcagatgactggcattggcatttctatgataccgtt
aaaggttccgattggttaggtgaccaagatgctattcattatatgactaaagaagcccca
gcttctatttacgaattggaacattatggtgtcccattctcaagaaatgatgagggtaga
atttatcaaagagcttttggtggtcaatccaaagaatttggtaaaggtggtcaagcatac
agaacttgtgctgttgctgatagaactggtcatgccttgttgcactccttatacggtcaa
tctttgagacacgactgtcatttctttattgaattctttgccatggatttgatgatgaag
gatggtgcttgtattggtatcattgcttataatgaagaagatggtactttgcacagattc
tttgctaacagaaccattatggctactggtggttacggtagagcttacttctcttgtact
tctgctcacacttgtactggtgatggttacgctatggtttccagagctggtttgccatta
gaagatttggaatttgttcaattccatccatcgggtatttatggttccggttgtcttatc
actgaaggtgctagaggtgaaggtggtttcttggttaactctgaaggtgaaagatttatg
gaaagatatgctccatcagccaaagatttagcttccagagatgttgtttctagagctatc
accatggaaattaacgaaggtagaggtgttggtccagaaaaggatcacatgtacttacaa
ttgagtcatattccagctccagtgttgaaagaaagattaccaggtatttctgaaactgcc
cacattttcgccggtgttgatgttactaaagaaccaattcctatcttaccaactgtccat
tataatatgggtggtatcccaaccaattggaaaggtgaagttttgaaaaagagtgctgat
ggtaacgatgaagttgttccaggtttgttagcttgtggtgaagctgcttgtgcttctgta
cacggtgccaatagattgggtgccaactctttgttggatttggttgtttttggaagagct
gttgcccacaccattagagataacttgcaaccaggtactccaatcccagatcacgctaaa
gatattggttatgaatcaattgctaacttggacaaactcagaaacgccaacggttctaaa
ccaactgctgatatcagattagaaatgcaaaagactatgcaaaagggttgtgctgtgttt
agaactcaagaaactttggaccaatgtgtggagcatattggagaagtggacaagagcttt
gaagatgtcaagactactgaccgttctatgatttggaactcagatttggttgaaactttg
gaattacaaaatttgttgacttgtgctacccaaactgctgcatctgctgctgctagaaca
gaatcaagaggtgctcattctagagatgacttcccagatagagatgatgtcaactggaga
aaacacacattatcttaccaagaaaccgttggtggtccagtgagattggattatagagat
gttgtcaagaccacattggacgaaaacgattgtaaaccagtcccaccagccaagagagtg
tattaa

DBGET integrated database retrieval system