KEGG   Candida albicans: CAALFM_CR04510WAHelp
Entry
CAALFM_CR04510WA  CDS       T00189                                 

Gene name
HXK2, CaO19.542
Definition
(RefSeq) hexokinase 2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cal  Candida albicans
Pathway
cal00010  Glycolysis / Gluconeogenesis
cal00051  Fructose and mannose metabolism
cal00052  Galactose metabolism
cal00500  Starch and sucrose metabolism
cal00520  Amino sugar and nucleotide sugar metabolism
cal01100  Metabolic pathways
cal01110  Biosynthesis of secondary metabolites
cal01130  Biosynthesis of antibiotics
cal01200  Carbon metabolism
Module
cal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cal_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAALFM_CR04510WA (HXK2)
   00051 Fructose and mannose metabolism
    CAALFM_CR04510WA (HXK2)
   00052 Galactose metabolism
    CAALFM_CR04510WA (HXK2)
   00500 Starch and sucrose metabolism
    CAALFM_CR04510WA (HXK2)
   00520 Amino sugar and nucleotide sugar metabolism
    CAALFM_CR04510WA (HXK2)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CAALFM_CR04510WA (HXK2)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CAALFM_CR04510WA (HXK2)
Membrane trafficking [BR:cal04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CAALFM_CR04510WA (HXK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 3641015
NCBI-ProteinID: XP_717405
UniProt: P83776
LinkDB All DBs
Position
R
AA seq 484 aa AA seqDB search
MVHLGPKPAQKRKGTFTDVSPQLLEALKPIQEQFTISADKLRAIVKHFISELDRGLSKAG
GNIPMIPGWVMDFPTGKETGSYLAIDLGGTNLRVVLVKLGGNRDFDTTQSKFALPAHMRT
ATSDELWDFIAKCLKEFVDEIYPDGCSEPLPLGFTFSYPASQNRINEGILQRWTKGWSID
GIEGKDVVPMLQKAIKKVGVPIDVVALINDTTGTLVASMYTDPEAKMGLIFGTGVNGAYF
DVVKDIPKLEGKCPSDIPPESPMAINCEYGSFDNEKYILPRTKYDVQIDEESPRPGQQTF
EKMISGYYLGEVLRLILLEFAEEKKLIFKGQNLDKLKVPYVMDASYPSKIEEDPFENLSD
VADLFREKLGIETTEPERKIIRCLAELIGERSARFSVCGIAAICQKRGYKTAHCAADGSV
YNKYPGFKERTAQALRDIYEWPADVKDPIIIVPAEDGSGVGAAVIAALTEKRLKEGKSVG
LLGA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatctcggtccaaaaccagctcaaaaaagaaagggaactttcactgatgtttct
cctcaattattagaagctcttaaaccaattcaagagcaattcaccatttctgcagacaaa
ttgagagctattgttaaacatttcatctcagaattagaccgtggtttatcaaaagctggt
ggtaacattcctatgattccaggttgggtcatggatttcccaaccggtaaagaaactggt
tcttatcttgccattgacttgggtggaaccaacttgagagttgtcttggttaaattgggc
ggtaacagagactttgacaccactcaatccaagtttgctttgccagctcacatgagaact
gccaccctggacgaattatgggattttattgctaaatgtttgaaagagtttgttgatgaa
atctacccagatggttgcagtgaaccattgccattgggtttcacatttagttatccagct
tctcaaaaccgtatcaatgaaggtatcttgcaaagatggactaaaggctggtcaattgat
ggaattgaaggaaaggatgttgttccaatgttgcaaaaagctattaagaaagttggtgtc
ccaattgatgttgttgcgttgatcaacgataccacaggtacattagttgcttctatgtac
acagacccagaagctaagatgggtttgatttttggtactggtgtcaacggtgcttatttc
gatgttgtcaaggacattcctaaattagaaggtaaatgtccatcagatattccaccagaa
tcaccaatggccatcaactgtgagtacggttcatttgataacgaaaagtatatcttgcca
agaactaaatacgatgttcaaattgacgaagaatcaccaagaccaggtcaacaaactttc
gaaaagatgatctccggttactatttgggagaagttttgagattgattttattggaattt
gctgaagagaagaaattgatcttcaaaggtcaaaaccttgacaagttgaaggttccatac
gtcatggatgcctcttatccatccaaaattgaagaagatccatttgaaaacttgtctgat
gtcgccgacttatttagagaaaaattgggcattgaaaccacagaaccagaaagaaagatt
atccgttgtttagcggaattgattggtgaaagatctgctagattctctgtttgtggtatt
gctgctatttgccaaaagagaggttacaaaaccgctcattgtgctgctgacggttcagtg
tacaacaagtacccagggttcaaagaaagaactgcccaagctttaagagacatctacgaa
tggccagctgatgtcaaggacccaatcatcattgttccagctgaagatggtagtggtgtt
ggtgctgccgttattgctgctttgaccgaaaagagattaaaagaaggtaaatccgttggt
ttgttgggtgcttag

DBGET integrated database retrieval system