KEGG   Candida albicans: CAALFM_CR05180CAHelp
Entry
CAALFM_CR05180CA  CDS       T00189                                 

Gene name
SDH2, CaO19.637
Definition
(RefSeq) succinate dehydrogenase iron-sulfur protein subunit
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cal  Candida albicans
Pathway
cal00020  Citrate cycle (TCA cycle)
cal00190  Oxidative phosphorylation
cal01100  Metabolic pathways
cal01110  Biosynthesis of secondary metabolites
cal01130  Biosynthesis of antibiotics
cal01200  Carbon metabolism
Module
cal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cal_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAALFM_CR05180CA (SDH2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CAALFM_CR05180CA (SDH2)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CAALFM_CR05180CA (SDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9
Motif
Other DBs
NCBI-GeneID: 3646397
NCBI-ProteinID: XP_711983
UniProt: Q59QN7
LinkDB All DBs
Position
R
AA seq 263 aa AA seqDB search
MFRSILHQQKAVQFSVRSLATAAAEKAPRLKKFQIYRWNPDTPEVQPKMQTYEVDLNKCG
PMVLDALLKIKNEQDATLTLRRSCREGICGSCAMNIGGRNTLACLCRIDQDESKDLKVYP
LPHMFVVRDLVPDLTHFYKQYKSIEPYLQRESNPADGRENLQSIEDRAKLDGLYECILCA
CCSTSCPSYWWNQQQYLGPAVLMQAYRWLIDSRDQATANRKAMLQNSMSLYRCHTIMNCA
RTCPKGLNPGKAIAEIKKQLAFD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgttcagatccattcttcatcaacaaaaagctgttcaattcagcgtaagatccttagct
actgcagctgctgaaaaggcaccaagattaaagaaatttcaaatttatagatggaaccca
gatactccagaagttcaaccaaaaatgcaaacctatgaagtcgatttgaacaaatgtgga
cctatggttttggatgctcttttgaaaattaagaatgagcaagatgctactttgacttta
agaagatcatgtcgtgaaggtatttgtggttcgtgtgccatgaacattggtggaagaaac
acattggcttgtttatgtcgtatagatcaagatgaatccaaagacttgaaagtttaccca
ttaccacacatgttcgttgtcagagatttagttccagatttgactcatttctataaacaa
tataaatccattgaaccatatttacaaagagaatctaatccagctgatggtagagaaaac
ttgcaaagtattgaagacagagctaaattagatggtttatatgaatgtatcttgtgtgct
tgttgttctacttcttgtccttcatactggtggaatcaacaacaatacttgggtccagca
gtcttgatgcaagcttatagatggttaattgattccagagatcaagccactgctaacaga
aaggccatgttacaaaactccatgtccttgtacagatgtcacactattatgaactgtgcc
agaacatgtccaaagggattgaatccaggtaaagctattgctgaaattaagaaacaattg
gcatttgattaa

DBGET integrated database retrieval system