KEGG   Caloramator sp. E03: FDN13_01665
Entry
FDN13_01665       CDS       T05994                                 

Definition
(GenBank) dephospho-CoA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
cale  Caloramator sp. E03
Pathway
cale00770  Pantothenate and CoA biosynthesis
cale01100  Metabolic pathways
cale01240  Biosynthesis of cofactors
Module
cale_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cale00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    FDN13_01665
Enzymes [BR:cale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     FDN13_01665
SSDB
Motif
Pfam: CoaE AAA_18 AAA_33 AAA_28 Cytidylate_kin2 AAA_17
Other DBs
NCBI-ProteinID: QCX32507
UniProt: A0A5B7TDJ8
LinkDB
Position
complement(307717..308319)
AA seq 200 aa
MKIIGLTGGIASGKSYVSEILKSKGIPVIDADAISREIVNKGSEALKEIESEFGKEILNE
DGTLNRKKLGCIVFSDKNKLETLNRIMHPKIIKEISERVEKIKSEGFKLCFIDAALLIET
GLYRITDIVILVYVDRQTQVERLIKRDNISLIEAEKRIESQMSFKEKMKYSHYIIDNNGS
REYTKQQICKIIEEIISMED
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaaataataggacttacaggaggaatagcatcaggaaaaagttatgtatcggaaata
ctaaaaagtaaaggtatacctgtaattgatgctgatgctatttcacgggagatagtaaat
aaaggtagtgaagccttaaaagagatagaaagtgaatttggtaaagaaattttaaatgaa
gatggcactttaaacagaaaaaagcttggatgtatagttttttctgataaaaacaaactt
gagacgttaaatagaataatgcaccccaagataataaaggaaatatcagaaagggttgaa
aaaataaaatcagaaggttttaagttgtgctttatagatgcagcacttttgattgaaact
ggactttatcgtataacagatattgtaatacttgtttatgtagatagacaaacacaagtg
gaaagactgataaaaagagataatatatccttaatagaagctgaaaaaagaatagagtct
caaatgagttttaaagaaaaaatgaaatattcacattatataattgataataacggaagt
agagaatatacaaagcaacagatatgtaaaattatagaggaaataatttctatggaggac
tga

DBGET integrated database retrieval system