KEGG   Calothrix sp. 336/3: IJ00_03835Help
Entry
IJ00_03835        CDS       T03937                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
calh  Calothrix sp. 336/3
Pathway
calh00620  Pyruvate metabolism
calh00680  Methane metabolism
calh00710  Carbon fixation in photosynthetic organisms
calh01100  Metabolic pathways
calh01120  Microbial metabolism in diverse environments
calh01200  Carbon metabolism
Module
calh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:calh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IJ00_03835
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    IJ00_03835
   00680 Methane metabolism
    IJ00_03835
Enzymes [BR:calh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     IJ00_03835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKG24423
UniProt: A0A0T7BZQ7
LinkDB All DBs
Position
complement(954428..957484)
Genome map
AA seq 1018 aa AA seqDB search
MSSLLYSFAQAVNIYPASDLFLRHRLQVMEDLWESVLRQECGQNMVDLLRQLRDLCSPEG
QATNDHAASVSKLIEQLNINEAIRAARAFALYFQLINIIEQDYEQRQQMTRYEEESSAMS
GDTFPNIISSHGEYQGEETPANSGLGADILARSWLAKSDSKNKGTFADLFPQLYRLNVPP
QQIQRLITQLDVQLVFTAHPTEIVRHTIRDKQRRVVQLLQELDMVEKRGNSWEASELKEQ
LIEEVRLWWRTDELHQFKPSVLDEVDYALHYFQEVLFDGIPDLYKRFKHALSGTFPWLQP
PSKNFCKFGSWVGADRDGNPSVTPEVTWQTACYQRNMVLEKYIKSVKRLISLLSMSLHWS
DVLPDLLESLELEQSQMSSVYEQLALRYRQEPYRLKMSYVLKRLENTRDRNMALYKGETP
KDSLPIYRSGDDFLAELRLIERNLTETGLTCRDLENLICQVEIFGFNLTSLDIRQESSRH
SDALNEILEYQGVLKQSYDSLSEEERVTWLAEELLTRRPLVPAELPFSEKTNDIIETLRT
VRSLQQEFGTNICQSYIISMCREVSDVLEVLLLAKEAGLYDPGTSIGTIQVVPLFETVED
LQRSRSVMRKLFELPLYRALLAGGYGEIDGNFESSRLPLSPTLPLKSSLTPNLQEVMLGY
SDSNKDSGFLSSNWEIHKAQKSLQTIAEEYGLTLRIFHGRGGSVGRGGGPAYEAILAQPG
HSINGRIKITEQGEVLASKYSLRDLALYNLETITTAVIQASLLGKGFDDIEPWNEIMEEL
AQRSRSHYRNLIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKRDLSSLRAIPWVF
SWTQTRFLLPSWYGVGTALQEFIDAEPEEHMKLLRYFYAKWPFFKMAVSKAEMTLAKVDL
QMASRYVEELSQPEDKQRFEKVFEQIASEYYLTRDLVLQITEHQRLLDGDPVLQRSVQLR
NGTIVPLGFIQVSLLKRLRQAKNSATSGVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccttttatactcttttgctcaggctgtgaatatctaccctgcctcagacttg
tttttacggcaccgtctccaggtgatggaagatttgtgggagtctgttctccgacaagaa
tgtggtcaaaatatggtggacttattgcggcaattacgcgatttatgttccccagaagga
caagcaacaaatgatcatgcagcctctgtatcgaagctgattgagcagctgaatatcaat
gaagccattcgagcagcccgcgcctttgccttgtatttccaattgattaacatcatagag
caagattacgagcaacggcagcaaatgactcgttacgaggaggaatcatcggcgatgtct
ggtgataccttccccaatattatttcctcccatggggagtaccaaggggaagaaactcct
gccaatagtggactaggggcagatattctggcaagaagttggttggcaaaatctgacagt
aaaaacaaaggcacctttgcggatttattcccccagctatatagattgaatgtaccaccc
cagcaaattcaacggctgatcactcaattagatgtgcagttagttttcaccgcacacccg
acagaaattgtccgtcatacgattcgtgacaaacagcgtcgggtagtccagttactccaa
gagttggatatggtggaaaaacggggtaatagctgggaagcgtcggaacttaaagagcaa
ttaattgaggaagtccgtttgtggtggcgtaccgatgagttacaccagtttaaaccctcg
gtgttagatgaggtagattacgccctccattacttccaggaagtattatttgatggtatt
cccgatttatacaaacgcttcaaacacgctttgtcgggaactttcccctggttacaaccc
cctagcaaaaacttttgtaaatttggttcttgggtgggtgcagatcgggatggcaacccc
tcggtaactccagaggtaacgtggcaaactgcctgttatcaacgcaatatggtgctggag
aaatacattaaatctgtcaagcgcttgattagcttgttgagtatgtccctgcactggagt
gatgtactcccagatttactggagtctctggaattagaacaatcccagatgagcagcgtc
tacgagcaattggcgttacgctaccgtcaggaaccctatcggttaaaaatgtcctatgtg
ctgaagcggttagaaaatacccgcgatcgcaacatggcactttacaaaggagaaactccc
aaagattccctacctatctatcgttcgggggatgattttttagcagagttgcgtctgatt
gagcggaatttaactgagactgggttaacctgtcgagacttggaaaatttgatttgccag
gtagagattttcggctttaatttgacttccttagatattcgtcaagaatcttcccgtcac
tccgatgctttaaatgagattctcgaatatcaaggagttcttaagcaatcctatgacagc
ttgtccgaggaagagcgggtaacttggttagcagaggaattattaacccgtcgtccttta
gttcccgcagaattacccttttctgagaaaaccaacgatattatcgagacactgcggaca
gtgcgatcgctccagcaagagtttggcaccaatatctgtcagagttacatcatcagtatg
tgtcgagaagtcagcgatgttctggaagtattattactcgctaaggaagcgggtttatac
gaccctggaacctccattggtacaattcaagtagttcccctctttgaaacggtcgaagat
ttacagcgctcccgcagtgttatgcggaaactgtttgaattacccctgtatcgagcttta
ttagcgggtggatatggcgaaattgatgggaattttgagtcttcccgtctccccctttcc
cccaccctacccctaaaatcctccctgacacccaaccttcaagaggtaatgttagggtat
tctgacagtaacaaagactctggctttttaagcagtaactgggaaattcataaggcacaa
aaatccctgcaaaccatcgccgaagaatatggtctgaccctgcggatattccacggacgg
ggtggttccgtgggacggggtggtggtcctgcctatgaggcgattttggcacagcccggt
cacagtattaacggcagaattaaaattactgaacagggagaagttctagcttctaaatat
tccctgcgagatttggcactgtataacctcgaaactatcaccaccgcagtcattcaagcc
agtttactcggtaaggggttcgatgatattgaaccttggaacgagattatggaagaatta
gcccagcgatcgcgctcccattaccgaaacctgatttacgagcaaccagatttcatcgac
tttttccaccaagttacccccatcgaagaaattagccaactgcaaatcagttcacgtcct
gcgcgtcgtccctccggtaaacgggatttgagcagtttacgggcaattccctgggtattt
agctggacacaaacccgcttccttctcccttcctggtatggtgtgggaacagctttgcag
gaatttatcgatgcagaaccagaggaacacatgaagctgctacgctatttctatgcgaaa
tggcccttcttcaagatggcagtttccaaggcagaaatgacccttgccaaggtagacttg
caaatggcaagccgctatgtggaagaattatctcaaccagaagataaacaacggtttgag
aaagtctttgaacaaattgccagtgaatactacctcacacgggatttagttttgcaaatc
accgaacatcagcgcttacttgatggcgatcccgtcttgcagcgttcggtacaactgcgc
aacggtactattgtccccctagggtttattcaagtttccctgctgaaacgtttgcgacaa
gctaaaaatagcgccacttctggggtgattcactcccgttacagcaaaggggaattgctt
cgtggtgcattacttaccattaacgggattgctgcgggaatgcgaaatactggttga

DBGET integrated database retrieval system