KEGG   Calothrix sp. 336/3: IJ00_09070Help
Entry
IJ00_09070        CDS       T03937                                 

Definition
(GenBank) glutathione S-transferase
Organism
calh  Calothrix sp. 336/3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_5 GST_C_2 GST_C_3 GST_C Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-ProteinID: AKG21423
UniProt: A0A0T7BRB9
LinkDB All DBs
Position
complement(2193541..2194212)
Genome map
AA seq 223 aa AA seqDB search
MADITIYSSVACPYAHRSRLALLEKGVEFELIEIDLQNKPAGFTDISPYGKVPAIAHNNK
QVWESAIINEYLDEVFPNPPLLPQNPLDKAQARIWIDFANTRFVTAFSNLLRSPDSETQE
EARRDLYKHLEFVENQALAKLSGNGSYWFGENISLVDLSFYPWFERLPALEYYRGFKLPS
EFTRLQQWQNAVSQRESVQKIANSQEFYIDRYARLATPVTAKN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatcacaatttatagctccgtcgcttgcccttatgcccatcgttcgcgtcta
gctttattagaaaaaggcgtagaatttgagttaatcgaaattgatttacaaaacaaacct
gcgggatttacagatatttctccttacggaaaagttccggcgatcgctcacaataataag
caagtttgggagtcggcaattattaacgagtatctcgacgaagtatttcccaatcctcct
ttattaccccaaaatcctcttgataaagcacaggcaagaatttggattgattttgccaat
actcgattcgtcactgctttctccaatttattacgttctcccgatagcgaaacacaagaa
gaagcaagacgagatttatacaagcatttagagtttgtcgaaaatcaagctttagctaaa
ctttcaggtaatggttcctactggtttggtgaaaatattagtttagtggatttaagtttt
tatccttggttcgagcgtttaccagcactcgaatactatcgtgggttcaaattaccatct
gaatttacccgtttacagcaatggcagaatgcagtcagtcagcgcgaatccgtgcagaaa
attgctaattctcaggaattttatatcgatcgatatgccagattagcaactcctgttact
gctaaaaactag

DBGET integrated database retrieval system