KEGG   Calothrix sp. 336/3: IJ00_09100Help
Entry
IJ00_09100        CDS       T03937                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
calh  Calothrix sp. 336/3
Pathway
calh00480  Glutathione metabolism
calh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IJ00_09100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:calh02000]
    IJ00_09100
Enzymes [BR:calh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     IJ00_09100
Transporters [BR:calh02000]
 Other Transporters
  Pores ion channels [TC:1]
   IJ00_09100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AKG21426
UniProt: A0A0T7BQR0
LinkDB All DBs
Position
2199579..2200262
Genome map
AA seq 227 aa AA seqDB search
MSTVHLYFAKASTFSQRTRVVLLEKGIEFTSTEIEFPNKPADFLQVSRYGKVPAIKHGDV
EIYESAIINEYLEEVFPEPALLPKELGKKAIARIWIDYANTRLVPAFNKFLRGKDASEQE
QGRKEFTEALLHIEREGLEKLSGNSLYFLGENLSLVDISFYPWFERLPILEQFRKFDLPA
ETPRLQTWWKTLRDRDSIKAVANPTEFYIERFAKILGEPIPVGASQN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagtacacctttacttcgccaaggcttctaccttttcccagcgtactcgcgtt
gtcttgctagaaaaggggattgaattcacctctacagaaattgaatttcccaataaaccc
gcagattttcttcaggtttctcggtacggaaaagtgccagcaatcaaacatggggatgta
gaaatttacgaatctgcgattatcaatgaatacttagaagaggtttttcccgaacctgca
ttgttaccaaaagaactgggtaaaaaagcgatcgcccggatttggattgactatgccaat
acccgtcttgtacctgcatttaataagtttttgcgcggtaaggatgctagtgaacaagag
cagggacgcaaagagtttaccgaggctctgttacatatcgaacgggaaggattagagaaa
ttatcgggaaacagtctctactttttgggtgagaatttgagcttagtcgatattagtttc
tatccttggttcgagcgcttaccaatcttagaacaattccgcaaatttgacctaccagca
gaaacccctcgcttgcagacatggtggaaaacattgcgcgatcgcgattcgattaaagca
gtggcaaatccaacagagttctatatcgaaaggtttgcgaaaatactcggcgaacccatt
ccagtgggagccagtcaaaactaa

DBGET integrated database retrieval system