KEGG   Calothrix sp. 336/3: IJ00_11675Help
Entry
IJ00_11675        CDS       T03937                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
calh  Calothrix sp. 336/3
Pathway
calh00010  Glycolysis / Gluconeogenesis
calh00053  Ascorbate and aldarate metabolism
calh00071  Fatty acid degradation
calh00280  Valine, leucine and isoleucine degradation
calh00310  Lysine degradation
calh00330  Arginine and proline metabolism
calh00340  Histidine metabolism
calh00380  Tryptophan metabolism
calh00410  beta-Alanine metabolism
calh00561  Glycerolipid metabolism
calh00620  Pyruvate metabolism
calh00625  Chloroalkane and chloroalkene degradation
calh01100  Metabolic pathways
calh01110  Biosynthesis of secondary metabolites
calh01120  Microbial metabolism in diverse environments
calh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:calh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IJ00_11675
   00053 Ascorbate and aldarate metabolism
    IJ00_11675
   00620 Pyruvate metabolism
    IJ00_11675
  Lipid metabolism
   00071 Fatty acid degradation
    IJ00_11675
   00561 Glycerolipid metabolism
    IJ00_11675
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IJ00_11675
   00310 Lysine degradation
    IJ00_11675
   00330 Arginine and proline metabolism
    IJ00_11675
   00340 Histidine metabolism
    IJ00_11675
   00380 Tryptophan metabolism
    IJ00_11675
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IJ00_11675
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    IJ00_11675
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    IJ00_11675
Enzymes [BR:calh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     IJ00_11675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKG21831
UniProt: A0A0T7BRX4
LinkDB All DBs
Position
complement(2763334..2764710)
Genome map
AA seq 458 aa AA seqDB search
MISQVEITGIIQNQKKFFSTNQSKNLEFRIHQLKTLKKLIINHESEIIQALQTDLGKPFY
EAFGTEIFVLLTEINYVLKNLRKWVKPQSVSIPLQFLPGRGKIIPEPLGVVLIISPWNYP
LQLVIAPLIGAIAAGNCAIIKPSEVAAATSQLIARLISEYFAHDYITVITGGVETTQALL
TEKFDHIFFTGGAAVGKIIMAAAAKHLTPVTLELGGKSPCIVDHDINLEVTARRILWGKF
LNCGQTCLAPDYLLVDARIKADLISEFRKCLREFYGENPVNSPDYGRIINQARFDKLLHL
LESTEIIMGGENNPQERYIAPTIVNNVRWDHPLMQEEIFGPILPIIEYTNISEAIAHINS
QPQPLALYLFSHQKSLQEQVLTTTSSGGVCINDTILHRGVPTLPFGGVSNSGIGSYHGKF
SFDRFSHHKSVFQNPVWLDLKWRYAPYAGKIGFLRRFL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgatttctcaagttgaaattactggaattattcaaaatcagaaaaagttcttctcaact
aatcaaagcaaaaatcttgaatttcgtatccatcaattaaaaacattaaaaaaattaatt
attaaccatgagtcagaaattatccaagccctgcaaactgatttaggtaaaccgttttat
gaagcttttggaacggagatttttgtcttattaacagagattaattatgtcctcaaaaat
cttcgtaaatgggtaaaacctcaatcagtttcaatacctctacaatttctaccaggaagg
ggaaaaattatcccagaaccccttggagttgttttaattatttctccttggaattaccct
ttacagttagtaattgctcctttaattggggcgatcgccgccggaaattgtgcaattatc
aaaccttcagaagttgctgcggctacttctcaattaattgctcgcttaatttctgaatat
tttgcccatgactatattactgtcattacaggtggtgtagaaacaactcaagcattatta
acagaaaaatttgaccatatcttttttactgggggggctgccgttggtaaaattattatg
gctgctgccgcaaagcatttgactcccgtcaccttagaattgggtggtaaaagtccttgt
attgtcgatcatgatattaatttagaagtgaccgctagacgaattctttggggtaagttt
ctcaattgtgggcaaacttgtttagcaccagattatttgttagtagatgccagaattaaa
gcagatttaatctcggaattccggaagtgcttacgggaattttacggtgaaaatccagtt
aatagtccagattatggtcgaataattaatcaagcacgctttgataaattactgcatctt
ctggaatctactgaaataattatgggaggagaaaataatcctcaagagcgttatattgct
cccactattgtgaacaatgtccgttgggatcatcctttgatgcaggaagaaatatttggt
cctattttaccaattatcgaatataccaatatctccgaggcgatcgcccacattaattcc
caacctcaacccttagctttatacctgttctcccatcaaaaaagcctgcaagaacaagta
ttaacaactacttcttccggtggtgtctgtatcaatgacaccattctccataggggtgta
cccactttacccttcggtggtgtaagtaatagtggtatcggtagttaccacggaaaattt
agctttgaccgattttctcaccataaaagtgtgttccaaaaccctgtttggttggattta
aaatggcgctacgcaccctatgcaggtaagataggatttttgcggcgcttcctttaa

DBGET integrated database retrieval system