KEGG   Calothrix sp. 336/3: IJ00_15835
Entry
IJ00_15835        CDS       T03937                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
calh  Calothrix sp. 336/3
Pathway
calh00010  Glycolysis / Gluconeogenesis
calh00020  Citrate cycle (TCA cycle)
calh00620  Pyruvate metabolism
calh01100  Metabolic pathways
calh01110  Biosynthesis of secondary metabolites
calh01120  Microbial metabolism in diverse environments
calh01200  Carbon metabolism
Module
calh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:calh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IJ00_15835
   00020 Citrate cycle (TCA cycle)
    IJ00_15835
   00620 Pyruvate metabolism
    IJ00_15835
Enzymes [BR:calh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     IJ00_15835
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2
Other DBs
NCBI-ProteinID: AKG22548
UniProt: A0A0T7BTX3
LinkDB
Position
3780491..3781732
AA seq 413 aa
MIEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHIIVPAGESAPVGAAI
ALLAATEAEIPAAIAQAQSAAKPTATTPATPAPVSAPVSESVSVGSNGSSRPSGRTVASP
RARKLAKDFKVDINSLIGSGPYGRIIAEDVEAAAGKVSTPAISAPVTPVSAPAPVAKPAP
APAPSVAAIPGQTTPFTTLQTAVIRSMNASLSVPVFRVGYTITTDSLDKLYKQIKSKGVT
MTALIAKAVAVTLKKHPLVNASYSDQGIVFHGNINVSVAVAMDDGGLITPVLQNADQQDI
YTLSRSWKSLVERARAKQLQPEEYSTGTFTVSNLGMFGVDKFDAILPPGQGGILAIGASR
PQIVATPDGMFGVKQQMQVNLTADHRIIYGAHAAAFLQDLAKLIETDAQSLTM
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgattgaaggtaaaatcgtttcttgggtaaaatctcccggtgacaaagtggaaaaaggc
gagactgtggtggttgtcgagtctgataaggcggatatggatgtagagtccttttatgag
ggatatttagcacatattatcgtgcctgccggggaaagcgcccctgtgggtgcagcgatc
gccctcttagcagcaacagaagcggaaattccggcggcgatcgcccaagctcaaagtgca
gccaaacccacagctacaacaccagcaacaccagcacctgtaagcgctcctgtcagtgaa
tctgtgtccgtcgggtcaaatggttctagtcgtccctctggacgcactgtagcttctccc
cgcgctcgcaaattagccaaagatttcaaagttgatatcaactctctgattggtagcggt
ccctacggtcgcattatcgccgaagatgtggaagccgcagctgggaaggtttctacccct
gctatttctgcccctgtcaccccggtttctgcccctgctcccgttgccaaacccgccccg
gcacctgcaccttcagtggcagcaatccctggtcaaaccacaccctttactaccctgcaa
actgccgtaattcgtagtatgaatgccagtttgtccgtaccagtattccgggttggttat
acaattacaacggatagcctggataaattatataagcaaattaaatctaagggcgtaacc
atgactgccctcattgccaaagctgtagcagtcaccttaaagaaacatcctttagtcaac
gccagctattctgaccaaggaattgttttccacggaaatatcaacgtatccgtagcagtt
gccatggatgacggtggtttaattacaccagtactacaaaatgctgatcagcaggatatc
tacaccctatcccgtagctggaaatccttggtagagcgtgctagagccaagcaacttcag
ccggaagaatacagcacaggtacttttaccgtttctaatttgggaatgttcggtgtggat
aaatttgatgccattttacccccaggtcaaggtggaattctggcgatcggtgcatctcgc
ccccaaattgttgctactcccgacggaatgtttggtgtcaaacagcaaatgcaagttaac
ttgactgctgatcaccgcatcatctatggcgctcatgcagcagcattcctgcaagattta
gctaagttgattgaaaccgatgctcaatctttaactatgtaa

DBGET integrated database retrieval system