KEGG   Calothrix sp. 336/3: IJ00_15835Help
Entry
IJ00_15835        CDS       T03937                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
calh  Calothrix sp. 336/3
Pathway
calh00010  Glycolysis / Gluconeogenesis
calh00020  Citrate cycle (TCA cycle)
calh00620  Pyruvate metabolism
calh01100  Metabolic pathways
calh01110  Biosynthesis of secondary metabolites
calh01120  Microbial metabolism in diverse environments
calh01130  Biosynthesis of antibiotics
calh01200  Carbon metabolism
Module
calh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:calh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IJ00_15835
   00020 Citrate cycle (TCA cycle)
    IJ00_15835
   00620 Pyruvate metabolism
    IJ00_15835
Enzymes [BR:calh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     IJ00_15835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKG22548
UniProt: A0A0T7BTX3
LinkDB All DBs
Position
3780491..3781732
Genome map
AA seq 413 aa AA seqDB search
MIEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHIIVPAGESAPVGAAI
ALLAATEAEIPAAIAQAQSAAKPTATTPATPAPVSAPVSESVSVGSNGSSRPSGRTVASP
RARKLAKDFKVDINSLIGSGPYGRIIAEDVEAAAGKVSTPAISAPVTPVSAPAPVAKPAP
APAPSVAAIPGQTTPFTTLQTAVIRSMNASLSVPVFRVGYTITTDSLDKLYKQIKSKGVT
MTALIAKAVAVTLKKHPLVNASYSDQGIVFHGNINVSVAVAMDDGGLITPVLQNADQQDI
YTLSRSWKSLVERARAKQLQPEEYSTGTFTVSNLGMFGVDKFDAILPPGQGGILAIGASR
PQIVATPDGMFGVKQQMQVNLTADHRIIYGAHAAAFLQDLAKLIETDAQSLTM
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaggtaaaatcgtttcttgggtaaaatctcccggtgacaaagtggaaaaaggc
gagactgtggtggttgtcgagtctgataaggcggatatggatgtagagtccttttatgag
ggatatttagcacatattatcgtgcctgccggggaaagcgcccctgtgggtgcagcgatc
gccctcttagcagcaacagaagcggaaattccggcggcgatcgcccaagctcaaagtgca
gccaaacccacagctacaacaccagcaacaccagcacctgtaagcgctcctgtcagtgaa
tctgtgtccgtcgggtcaaatggttctagtcgtccctctggacgcactgtagcttctccc
cgcgctcgcaaattagccaaagatttcaaagttgatatcaactctctgattggtagcggt
ccctacggtcgcattatcgccgaagatgtggaagccgcagctgggaaggtttctacccct
gctatttctgcccctgtcaccccggtttctgcccctgctcccgttgccaaacccgccccg
gcacctgcaccttcagtggcagcaatccctggtcaaaccacaccctttactaccctgcaa
actgccgtaattcgtagtatgaatgccagtttgtccgtaccagtattccgggttggttat
acaattacaacggatagcctggataaattatataagcaaattaaatctaagggcgtaacc
atgactgccctcattgccaaagctgtagcagtcaccttaaagaaacatcctttagtcaac
gccagctattctgaccaaggaattgttttccacggaaatatcaacgtatccgtagcagtt
gccatggatgacggtggtttaattacaccagtactacaaaatgctgatcagcaggatatc
tacaccctatcccgtagctggaaatccttggtagagcgtgctagagccaagcaacttcag
ccggaagaatacagcacaggtacttttaccgtttctaatttgggaatgttcggtgtggat
aaatttgatgccattttacccccaggtcaaggtggaattctggcgatcggtgcatctcgc
ccccaaattgttgctactcccgacggaatgtttggtgtcaaacagcaaatgcaagttaac
ttgactgctgatcaccgcatcatctatggcgctcatgcagcagcattcctgcaagattta
gctaagttgattgaaaccgatgctcaatctttaactatgtaa

DBGET integrated database retrieval system