KEGG   Calothrix sp. 336/3: IJ00_19700Help
Entry
IJ00_19700        CDS       T03937                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
calh  Calothrix sp. 336/3
Pathway
calh00500  Starch and sucrose metabolism
calh01100  Metabolic pathways
calh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IJ00_19700
Enzymes [BR:calh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     IJ00_19700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AKG23202
UniProt: A0A0T7BVP9
LinkDB All DBs
Position
4747981..4750560
Genome map
AA seq 859 aa AA seqDB search
MQPIRTFNVSPSLPSQLEPLRKLAYNLHWDWNVETKDLFRRLDPDLWESSHHNPVLMLGS
ISQARLTAVVEDEGFLAQMGRAAQQLEDYLQERTWYKKNRHQGLVNPNHSGECYAYFSAE
FGLTDCLPIYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYPI
NDFYNMPLHLERNPDGSELRIGVDYPGRTVYARVWRVQVGTVPLYMLDTNIEPNNPYDHD
ITDQLYGGDIDMRIHQEMMLGIGGVKMLKALGYNVTAYHMNEGHAAFSALERIRNLIQEQ
GLSYAEAKQVVTSTNIFTTHTPVPAGIDLFPPDKVLHYLGYYADIFGLPKDQFLALGREN
TGDLSSPFSMAVLALKMAGFSNGVAQLHGVVSRQMFKDLWQNLPVQEVPITAITNGVHAR
SCVAKSTQELYDRYLGPNWSSVGTDHPVWERMNAIPDEELWRNHERCRLDMILYVREHLV
KHLRDRGASPSDIAQAQEVLDPNVFTIGFARRFATYKRATLWMRDLDRIKKILLGNKHRK
VQFVIAGKAHPKDIPGKELIRDINHFIQEQDLHKQVVFVPNYDIHISRLMVAGCDIWLNT
PRRPREASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGEMYDDPNYQDEIEAN
ALYELLEKEVVPLFYDRDADALPRPWIAKMKDAIRLNCPFFNTARMVGEYAENAYFPASD
RYHDLTVDNYAPAKELAAWKANLSEHWYNIIVKEVNVSSGTDIEVNQTVEVKAKVDLATL
NQNDVQVELYQGAIDANGDIVNGVSVVMDYQGNETQGLSTYTANITYTTSGLQGLCLRVL
PKHKYLSSPYEPRLILWAD
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctattcgtacattcaatgtatctccctccctgccttcgcaactagaacccctg
cgaaaactggcatataatttacactgggattggaacgttgaaaccaaagacctatttcgg
cgtttagacccagacctatgggagtccagccaccataacccagtgctgatgctaggaagt
attagccaagcacggttaacggcagttgtcgaggatgaaggttttttagcacagatgggt
cgtgctgcccaacagctagaagattatctgcaagagcggacgtggtataaaaaaaatcgc
catcaaggactagttaatcccaatcactctggagagtgttacgcctacttttcagctgag
tttggactgacagattgtttacccatttactccggtggtttaggtgtgcttgccggcgat
cacctgaaatcagctagtgatttgggtttacctttagtgggtgttggtctactttatcaa
cagggttattttgctcaatacctgaatgcagacggttggcaacaagaacgttacccgata
aatgacttttataatatgccattgcacttggagcgtaatcctgatggttctgagttaaga
attggggttgattatccgggaagaactgtctatgcaagggtgtggcgagttcaggtaggt
acggttcctctgtatatgctcgataccaacattgaacccaataatccctacgaccatgat
attaccgaccaactctatgggggtgatatcgatatgcggattcaccaagaaatgatgttg
gggattggtggagtcaagatgctaaaagcattgggctataatgtcaccgcctaccatatg
aatgaaggtcatgcagctttttctgccctggaacggattcggaacttaattcaagagcaa
gggttaagttatgcagaagccaaacaggttgtaacttccaccaatatctttactacccat
actcccgttccggcagggattgatttgttcccccctgataaggtattacattatctgggt
tactatgcagatattttcggcttaccgaaagaccagttcctagcccttggtcgtgagaat
acaggggatttatcctcacctttcagtatggctgtattagccttgaagatggcaggtttt
tctaatggggtggcacagttgcatggggtagtgtcacggcagatgtttaaggatttgtgg
caaaatttacccgtgcaggaagtaccaattacggcaattactaatggtgttcacgctcgt
agttgtgttgccaagtctacccaagaattatacgatcgctacttaggtcccaattggtca
tccgttggcaccgatcatcctgtgtgggaaaggatgaatgcaattcccgatgaggaactg
tggcgcaaccatgagcgctgccgtttggatatgattttatatgtgcgggagcatttagtg
aaacatctgcgcgatcgcggtgcttctcccagtgacattgcccaagcacaggaagtgtta
gatccgaatgtgtttaccattggttttgctcgacgttttgccacctacaaacgcgctacc
ctgtggatgcgtgacttagacaggattaaaaagatattactcggtaataaacaccggaaa
gttcagtttgtgattgccggaaaagcccatcctaaggatatccctggtaaggaacttatc
cgtgatattaaccactttatccaggaacaggatttacataaacaggtggtttttgtaccc
aattacgatattcatatttctcgtctaatggtggcaggatgtgatatctggttaaataca
ccccgtcgcccaagggaagcttctggtacaagcggaatgaaagcagcgatgaacggatta
cccaatctcagtgttttagatggttggtgggatgaagctgactatgtgcgcactggttgg
gcaatcggacatggagaaatgtatgatgaccccaattatcaagatgagattgaggctaat
gctctctatgagttactagaaaaggaagttgtacccctattctatgaccgtgatgctgat
gccttgcctcgaccctggattgctaaaatgaaagatgccattcgtttgaattgccctttc
tttaatacagcccggatggtgggagaatatgccgaaaatgcctatttccccgcgagcgat
cgctatcatgatttgactgtggataactatgctcccgccaaggaattagctgcttggaaa
gcgaatctcagcgaacattggtataatattatcgtcaaagaagtcaatgtatcttctggc
actgatattgaggtaaatcaaaccgtcgaggtcaaggcaaaagttgacctggctaccctg
aatcaaaatgatgtgcaggtcgaattatatcaaggcgcaattgatgccaatggggatatt
gtcaacggtgtatctgtagttatggactaccaaggcaatgagacacaaggattaagtact
tacacggcaaatattacctatacaacctctggtttacaaggtttatgtttgcgtgtctta
cccaaacataaatacctctcttccccctacgaaccaagattgattttgtgggcagattaa

DBGET integrated database retrieval system