KEGG   Calothrix sp. 336/3: IJ00_23095Help
Entry
IJ00_23095        CDS       T03937                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
calh  Calothrix sp. 336/3
Pathway
calh00040  Pentose and glucuronate interconversions
calh00051  Fructose and mannose metabolism
calh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IJ00_23095
   00051 Fructose and mannose metabolism
    IJ00_23095
Enzymes [BR:calh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     IJ00_23095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AKG23796
UniProt: A0A0T7BXJ4
LinkDB All DBs
Position
5548573..5549619
Genome map
AA seq 348 aa AA seqDB search
MKAQVFRGVNNLSYEEVPVPILEADEVLVQVSVVGLCQSDIKKIRYPLYEPPRIFGHETA
GTITAVGSEVKNWQLGQRVAVMHHIPCMRCDYCLNENYSMCDTYKNIVTTAGFAPSGGGF
AEYVKIPGHIVRNGGLIPIPDHISFEEASFVEPTNCCLKAVKKAQIAPGQTVLITGAGPI
GLMFIMLVKLFGGKAIATDLLPSRIEKALSVGAEAAFDARDADLPGKIQALTNGMGVDVT
LLAVPNDKAFFQALDCTRKGGKILFFAEFPDEVEIPLNPNILYRREIDLMGSYSSSYKIQ
SLAADIVFNRRIDVNALISDRYPLQDLSQAVDQAIAPTPETYKILIYP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacaagtatttcgaggcgtaaataatttatcctacgaagaagtacccgtaccc
atcctagaagccgatgaagtgctggtgcaggtcagtgtcgtgggattgtgtcagtcagat
atcaagaaaattcggtatccgttgtatgaaccgccacggatttttggtcacgaaacggcg
ggaaccattaccgcagttggcagtgaagtcaaaaactggcagttagggcaacgggtggca
gtcatgcaccacattccctgtatgcgctgtgactactgcttgaatgaaaattactcgatg
tgtgacacctacaaaaatattgtcaccacggcgggttttgctcccagtggcggtggattt
gctgagtatgtcaagattccaggtcatattgtcaggaatgggggcttaattcctatcccc
gatcatatttcctttgaagaagcgagttttgtggaaccgaccaactgctgtttaaaggcg
gtgaaaaaagcccaaattgctcccggacagacagtgctaattactggagccggaccaatt
ggcttgatgtttattatgttggtgaagttatttggtggcaaggcgatcgccacagattta
cttccctcccgtattgagaaagcattgagtgtgggtgcagaagctgcatttgatgcccgg
gatgcggatttaccaggaaaaatccaggctttaactaacggtatgggtgtggatgtcacc
ctgcttgcggttcctaacgataaagcatttttccaagctctagattgtacccgtaagggt
ggcaagattctcttctttgccgaattccccgacgaagtagaaattcccttaaatccgaat
attctctatcgtcgagaaattgacttgatgggaagttacagttcttcctacaaaatccag
agtttagcagcagatatcgtcttcaatcgtcggattgatgtgaatgctctgattagcgat
cgctatcccctccaggatttatcccaagctgtagaccaggcgatcgcacccacaccggaa
acctataaaatcttgatttatccgtaa

DBGET integrated database retrieval system