KEGG   Calothrix sp. 336/3: IJ00_23780Help
Entry
IJ00_23780        CDS       T03937                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
calh  Calothrix sp. 336/3
Pathway
calh00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:calh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IJ00_23780
Enzymes [BR:calh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     IJ00_23780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AKG23922
UniProt: A0A0T7BXT2
LinkDB All DBs
Position
complement(5705041..5706531)
Genome map
AA seq 496 aa AA seqDB search
MTFRCQNYINGQWLDAITSDTLESRNPANTEELVATFPRSNSPDVNAAVAAARHAYQTWR
QIPAPTRAEYIFKVGEILTQYKEELAQLISQEMGKPIAEARGDVQEGIDCAFYSAGEGRR
LYGQTTPSEMPNKFAMTVRVPIGVCALITPWNFPVAIPCWKAMPALVCGNTVILKPAEDT
PACATKLIEIFAAAGFPPGVVNLVHGVGEEVGKALVEHPDVDLVSFTGSSQTGAEVGGIC
GRSHKRVCLEMGGKNAQIVMEDADLELALEGAIWGAFGTTGQRCTATSRLILHRDIKEKF
TQMLQSRASQLRLGAAIDPNTEIGPIINHRQLQQVRQYIDIAREEGAKVVMGGDIAREGE
LGKGYFFLPTILDGVTPGMRVAQEEIFGPVVAVMEVNDFAEAIAIINNTNYGLSSSIYTR
DINRAFAAIRDIEAGITYINGPTIGAEVHLPFGGVKRTGNGHREAGSTALDIFTEWKTVY
VDFSGSLQRAQIDNRS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttagatgccaaaactatatcaatggtcaatggttggatgccataacatcagat
actctagaaagtcgtaatcctgcgaatacggaagaacttgttgccacctttccccgctcc
aattctccagatgtcaatgccgccgtcgctgctgcacgtcatgcttatcaaacctggcga
cagattccagctcccaccagagccgaatatatatttaaagtcggagaaattctgactcag
tataaagaagaacttgcccaactcatcagccaagaaatgggcaaacccatagcagaagct
aggggagatgtccaggaaggtatcgattgcgccttttatagtgctggagaggggcgaaga
ttatacggacaaacgacaccctcagaaatgccgaataagttcgccatgacggtacgggtg
cccattggtgtctgtgcattaattacaccctggaattttcccgtagccatcccctgctgg
aaagcaatgccggctttagtttgtgggaatactgtaattcttaagcctgcggaagatacc
cctgcttgtgcaacgaaattaatagaaatttttgccgccgcaggtttccccccaggagtg
gtaaatttagttcacggagttggggaagaagtaggtaaagccttagtagaacacccagat
gtggatttagtttctttcacaggttcttcccagacgggagctgaggtggggggaatttgt
ggacgtagccataagcgcgtatgtttggaaatgggtgggaaaaatgcccagattgtcatg
gaagacgcggatttagaattagctttagagggggcgatctggggcgcatttggtacgaca
gggcaacgttgtactgccactagtcggttaattttgcaccgcgatatcaaggaaaaattt
actcagatgttgcaatcacgggcgagtcagttacgattaggtgcagcaattgaccccaat
acggaaattggaccgataattaatcacagacaattacaacaggtgcggcagtacatagat
attgcccgtgaagagggagcaaaggtggtaatgggtggtgatatcgctagggagggagaa
ctaggaaaaggttatttcttcttaccgacgattttggatggggtgactccagggatgcga
gttgctcaggaagaaatttttggtcccgtagttgctgtaatggaagttaatgattttgcc
gaggcgatcgccatcattaacaatacaaattatggattatcttcttctatatatacccgc
gacattaatcgtgcttttgccgcaatccgggatattgaagccggaatcacctatatcaat
ggtccgacaattggtgcagaagtgcatttaccctttgggggtgtgaaacgaacgggtaat
ggacaccgagaagcgggaagcactgctttagatatctttaccgagtggaagacagtatat
gtagacttttctggcagtttacaacgagcacaaattgataatcggagttag

DBGET integrated database retrieval system