KEGG   Calothrix sp. PCC 7507: Cal7507_0319Help
Entry
Cal7507_0319      CDS       T02358                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00630  Glyoxylate and dicarboxylate metabolism
calo00710  Carbon fixation in photosynthetic organisms
calo01100  Metabolic pathways
calo01120  Microbial metabolism in diverse environments
calo01200  Carbon metabolism
Module
calo_M00165  Reductive pentose phosphate cycle (Calvin cycle)
calo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
calo_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:calo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cal7507_0319
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cal7507_0319
Enzymes [BR:calo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cal7507_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Ncstrn_small
Motif
Other DBs
NCBI-ProteinID: AFY30817
UniProt: K9PE41
LinkDB All DBs
Position
complement(324364..324693)
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDAQIAKQVQYILNQGYIPAIEFNETSEPTELYWTMWKLPL
FGAKSTQEVLSEVQGCRSQFNNSYIRVVGFDNIKQCQVLSFLVHKPSRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttaccaaaagagcgtcgttacgaaaccctttcctatcttccccccctgact
gacgctcaaatcgccaagcaagtacagtacatcttgaatcaaggttacattccagcgatc
gagttcaatgagacctctgagccaacagaattgtactggacaatgtggaagttgcctttg
ttcggcgctaaatctactcaagaagtactgagcgaagtccaaggatgccgttctcaattc
aacaacagctacatccgtgtagtgggttttgacaacatcaagcagtgccaagttctcagc
tttcttgttcacaaacccagcagatactaa

DBGET integrated database retrieval system