KEGG   Calothrix sp. PCC 7507: Cal7507_0532Help
Entry
Cal7507_0532      CDS       T02358                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
calo  Calothrix sp. PCC 7507
Brite
Enzymes [BR:calo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cal7507_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: AFY31024
UniProt: K9PE47
LinkDB All DBs
Position
561287..561889
Genome map
AA seq 200 aa AA seqDB search
MAFVQAPLPYDFNALEPYGMKAETFEYHYGKHHKAYVDNLNKLTDGTELADKSLEEVIQI
SYKDSSKVGIFNNAAQVWNHTFFWSSLAPAGGGTPTDELAAKIDKDFGSLDKLKEEFSNA
AATQFGSGWAWLIDDGGTLKVIKTPNAENPLAYGQKALLTLDVWEHAYYIDYRNARPGYI
KNFLDQLINWDFAAENLAKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgtacaagctcccctaccttacgacttcaatgctctagagccatacggcatg
aaagctgaaaccttcgagtatcactatggcaagcatcacaaagcttatgtagataacctc
aacaagctcactgatggtacagaactcgctgacaagtcactagaagaagtcattcaaatt
tcctataaagactcctctaaggtgggaatttttaacaacgccgcccaagtttggaaccac
accttcttttggagttccctagcgcctgcaggtggcggcacacccaccgatgaattagct
gccaagattgacaaagattttggtagcttagacaagttaaaagaagaattttctaacgct
gctgcaactcaattcggtagtggctgggcttggttgattgatgatggtggcacactgaag
gtgatcaagacaccaaatgcagaaaaccctttagcttatggacaaaaagcactcctaact
ttagatgtttgggaacatgcttactacatcgattacagaaatgctcgtcctgggtacatc
aagaatttcttagatcagttgatcaactgggacttcgctgctgaaaacctcgcaaaagct
tag

DBGET integrated database retrieval system