KEGG   Calothrix sp. PCC 7507: Cal7507_1815Help
Entry
Cal7507_1815      CDS       T02358                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00500  Starch and sucrose metabolism
calo01100  Metabolic pathways
calo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cal7507_1815
Enzymes [BR:calo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Cal7507_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AFY32270
UniProt: K9PFR4
LinkDB All DBs
Position
complement(1985498..1988062)
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPQRLEPLRPLAHNLHWDWNVDTKDLFRRLDPDLWESSRHNPVLMLGT
ISQSRLSEVVEDEGFLAQMDRAARQLEDYLQEHTWYQKQRSQKPKEVYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYPINDFYNM
PLHLERNPDGSELRIAVEYPGRQVYARVWRVQVGTVPLYLLDTNIEPNNPYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYKVTAYHMNEGHAAFSALERIRGLMQEEGLSYAD
AKQVVASSNIFTTHTPVPAGIDLFAPDKILYYLGYYADIFGLPKEQFLGLGRENTGDLSG
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWKKVPVDEVPIAAITNGVHARSCVAKS
TQELYDRYLGPNWSSAPVDSQLWERMEAIPDEELWRNHERCRLDMVLYVREHLVKHLRDR
GASASEIAQAQEVLDPKVLTIGFARRFATYKRATLWMRDLDRIRQILLGNKDRKVQFVIA
GKAHPKDIPGKELIRDINHFIREQHLEKQVVFVPNYDIHISRLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADFVRTGWAIGHGENYDDPNYQDEVEANALYDLI
EKEVAPLFYDHRDADGLPRPWVAKMKDAIRLNCPFFNTARMVREYAERAYFPASDRYHTL
TADNYLPAKELAEWKANVSEHWFNITIKDIDVSAAADIEVNQTVAVKAKVDLATLTNNDV
QVELYQGAIDANGDIVNAIPVVMDYQGEDAQKLSIYTANITYTTSGLQGLSLRVLPKHKY
LSSAYEPRLIVWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgtacatttaacgtttctccttcactaccgcagcgactagaaccattg
cggccgctagcacacaacttacactgggattggaacgttgataccaaagatttatttcgt
cgtttagaccccgatctgtgggagtctagccgtcataacccagttctaatgctcggtact
atcagtcaatcgcggctttcggaagttgtagaagatgaaggcttcctcgcgcaaatggat
cgcgcagctcgtcagttagaagattatctgcaagaacacacttggtaccaaaaacagcgg
agtcagaaaccaaaagaagtatacgcttatttttcggctgaatttggacttgtagattgt
ttgcccgtttattctggtggtttgggtgttctcgcgggggatcacctcaaatctgctagt
gatttggggctaccgttggtgggtgtaggcttgctatatcagcaaggctactttgctcaa
tatttgaatgctgatggttggcagcaggaacgctatccaatcaatgatttttataatatg
cctttgcatctggaacgtaatccggatggttcagaattgcggattgcggtggagtatcca
ggacggcaagtgtatgcccgtgtttggcgtgtacaggtggggactgtgccactgtatctg
ttagatacaaacattgaaccgaataatccttacgatcacgacatcacagatcagctttat
ggtggcgacatcgatatgcgtatccaccaggaaattatgctggggatcggtggtgtgcag
atgttgaaagcattgggctataaagtcactgcttatcacatgaatgaaggtcacgctgcc
ttctctgccttggagcgtatccgcggactaatgcaggaagaggggttgagttatgcggat
gctaaacaggttgtagcttctagtaatatcttcactactcatacgccggtgcccgcaggg
atagacttgtttgctcctgacaagattttgtattacctgggatattatgcagatatcttt
ggcttgcctaaagagcaatttttagggctggggcgagaaaatacaggtgatttatccggg
cctttcagtatggcggtgttggcgctgaagatggcgacgttttctaacggggtggcgcaa
ctgcatggtgtggtttcacgccagatgtttcagggcttgtggaagaaggtaccagtggat
gaagtgccgatcgccgcaattactaacggcgttcatgcccgcagttgtgtcgcgaaatca
actcaggagttgtacgatcgctatcttggccccaactggtcatcagcaccagtagatagc
caattgtgggagcgcatggaagccattcctgatgaggagttgtggcgcaaccacgaacgc
tgtcgcttggatatggttttatatgtgcgggagcatttggtgaagcatttacgcgatcgc
ggtgcttctgcttcagaaattgcccaagcccaagaagttctcgatcccaaggttctcact
attggttttgcccgccgctttgctacctacaaacgcgctactttgtggatgcgtgattta
gatcgcatcaggcaaattttgttgggtaataaagaccgcaaagtccaatttgtgatcgct
gggaaagcacaccccaaagatattcccggtaaagaactcatccgtgacatcaatcatttt
atccgcgaacaacacttagaaaaacaagtagtgtttgttcctaattacgacattcatatt
tctcggttgatggtggctggttgcgatatctggttaaatacgccacgtcgtccccgcgaa
gcctctggtaccagtggtatgaaagccgcaatgaatggattgcctaatttaagcgtcctg
gatggctggtgggatgaggctgattttgtccgcactggttgggcgatcggacatggtgaa
aactacgacgatcccaattatcaagatgaggttgaagccaacgctctctacgatttgatt
gagaaagaagtagcacccctattttatgaccatcgggatgctgatggcttgccccgtccg
tgggttgccaaaatgaaagatgccatccgcctgaattgtccgttttttaatacggcgcgg
atggtgcgagaatatgcagaacgggcttatttccccgccagcgatcgctaccacaccctc
actgctgataattacctcccagccaaagaattggcagaatggaaagcaaatgtaagtgaa
cactggttcaatatcaccatcaaagatattgacgtatcagcagccgcagatattgaggtt
aaccaaaccgttgctgtcaaagccaaggtagacttggcaactttgacaaacaacgatgtg
caggtagaactgtaccaaggtgcgatcgatgccaatggcgatattgtcaacgctattccc
gttgtcatggattaccaaggagaggatgctcaaaaattaagtatttacacggctaacatc
acctacacaacctctggtttacaaggcttgtctttgcgggtattgccaaaacacaaatac
ctctccagtgcttatgagccaaggctaattgtttgggcagaataa

DBGET integrated database retrieval system