KEGG   Calothrix sp. PCC 7507: Cal7507_3273Help
Entry
Cal7507_3273      CDS       T02358                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:calo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cal7507_3273
Enzymes [BR:calo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Cal7507_3273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFY33679
UniProt: K9PLK8
LinkDB All DBs
Position
3736137..3737633
Genome map
AA seq 498 aa AA seqDB search
MTTPLTCRNYIDGQWLSAGGANTLESRNPALVTEVVATFPRSSAHDVNLAVAAARKAYHS
WRKVPAPARAEYVFRVGELLLQHKEELAQLMSREMGKPLTEARGDVQEGIDCAFYSAGEG
RRLFGQTTPSEMPNKFAMTVRTPVGVCALITPWNFPIAIPCWKAMPALVCGNTVILKPAE
DTPACATKLIEIFAAAGLPPGVINLVHGVGEEAGKALVEHPEVDLVSFTGSSETGAFVGA
TCGRTHKRVCLEMGGKNAQVVMEDADLELALDGAIWGAFGTTGQRCTATSRLILHHDIKE
KFTAMLYERTSKLRLGAGNAADTDIGPLVNEAQLQRVSNYLDIAREEGAEVLIGGKIASE
GSLKNGYFFQPTILDGVTPDMRVAREEIFGPVVALIEVRSFAEAIAILNNTNYGLSSSVY
TRDINRAFTAIRDIEAGITYINGPTIGAEVHLPFGGVKNTGNGHREAGTTALDVFTEWKS
VYVDFSGSLQRAQIDNRS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacaactccgcttacctgtcgtaattatattgatggtcaatggctaagtgctggtggg
gcaaacaccctagaaagccgtaacccggctttagtcaccgaagtcgttgccacttttcct
cgttcttcagcccatgatgtcaatttagcagtagctgctgcccgcaaagcctaccatagt
tggcgaaaagtccccgccccagctagagccgaatatgtctttcgcgtcggagaactcttg
ctgcaacataaagaagaacttgcccagttaatgagtcgggaaatgggtaaacccctgact
gaggctagaggagatgtgcaggaaggtattgactgtgccttttatagtgctggcgaagga
cggcgattatttgggcaaactacaccgtcggaaatgcccaacaaatttgcgatgacggtg
cggacacccgtgggggtttgtgccttaatcacaccctggaattttcccatagccatacct
tgttggaaagcgatgccagctttagtgtgtggtaatacagtcatcctcaaacccgctgaa
gataccccggcctgtgcaactaaactgatagaaatttttgctgctgcaggtttaccacca
ggagtgattaacttggtgcatggtgtgggtgaagaagcagggaaagctttagttgagcat
ccagaggttgatttggtgtcttttaccggttcctcagaaactggcgcttttgtgggcgcg
acttgcggacgcacccacaagcgtgtctgtctggaaatgggcggtaaaaatgctcaagta
gtgatggaagatgctgacttagaactggcattagatggggcaatttggggagcttttggg
acaaccggtcagcgttgtacagccactagtcgcttgattttgcatcacgatattaaagaa
aaatttactgccatgctttatgagcgtaccagtaagttacgcttgggtgcggggaacgca
gctgacacagacattggcccattagtcaatgaagcgcaattgcaacgggtgagcaattat
ttagatattgcccgcgaagaaggagcggaagtcttaattggtgggaaaattgccagtgag
ggttcactaaaaaacggttacttttttcaaccaactatcttagatggtgtgactcctgat
atgcgggttgctcgtgaagagatatttggcccagtggtggcattaattgaggtgagatca
tttgcagaggcgatcgctatcctcaacaacacaaactacggtctttcttcttcagtgtac
acccgcgacatcaaccgggcgtttaccgccatacgtgacatcgaagccggtatcacctac
attaatggccccaccatcggcgcagaggtacatctaccttttggtggtgtgaaaaatact
ggtaacggacaccgggaagccggaactacagccttagatgtgtttaccgaatggaagagt
gtttatgttgacttttccggcagtttacaacgcgcccaaatagataatcgcagttaa

DBGET integrated database retrieval system