KEGG   Calothrix sp. PCC 7507: Cal7507_4477Help
Entry
Cal7507_4477      CDS       T02358                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:calo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cal7507_4477
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:calo02000]
    Cal7507_4477
Enzymes [BR:calo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cal7507_4477
Transporters [BR:calo02000]
 Other Transporters
  Pores ion channels [TC:1]
   Cal7507_4477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_C_5 GST_C Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-ProteinID: AFY34846
UniProt: K9PPI4
LinkDB All DBs
Position
complement(5093429..5094103)
Genome map
AA seq 224 aa AA seqDB search
MAEITIYSAVVCPYAHRTRLVLQEKGIDFDLVEIDLQNKPEGFTKVSPYGKVPAITHGDE
RVWESAVINEYLDEVFPHPPLLPSNPIAKAQARIWVDFANTRFVPAFSNLLRNPEPQKQE
EAKQELYKHLEFIENEAFGKLSQDGPYWFGESISLVDFTFFPWFERWAALREYRGFAIPA
EFTRIKQWKHALKERDSVKAIAHSKEFYIERYAKFAAPAVAAVR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatcaccatctatagtgcagtcgtttgtccttatgctcaccgtactcgtttg
gtactccaagagaagggcattgacttcgatttagttgagattgatttgcagaacaaacca
gagggttttacaaaagtttctccctatggtaaagtcccggctatcactcacggtgatgaa
cgggtttgggaatcagcagtcattaatgagtatctagatgaggtatttcctcatccgcct
ctgttacccagcaatcctattgctaaagcacaggctcgcatctgggttgatttcgctaat
actagattcgttcccgctttctctaatcttttgcggaatccagaaccccaaaagcaagag
gaagctaaacaggaactatataaacatctggaattcatcgaaaacgaagctttcggtaag
ctttctcaggatggcccctactggtttggtgagtctatcagtctagttgattttaccttt
ttcccctggtttgaacgctgggctgcactgagagagtatcgcggttttgcgataccggct
gaatttacccggatcaagcaatggaaacatgctctcaaggagcgtgattcagtgaaagcg
atcgcacactctaaagaattctacatcgagcgctacgctaaattcgctgctccggctgtt
gcggctgtcagataa

DBGET integrated database retrieval system