KEGG   Calothrix sp. PCC 7507: Cal7507_4616
Entry
Cal7507_4616      CDS       T02358                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00010  Glycolysis / Gluconeogenesis
calo00020  Citrate cycle (TCA cycle)
calo00620  Pyruvate metabolism
calo01100  Metabolic pathways
calo01110  Biosynthesis of secondary metabolites
calo01120  Microbial metabolism in diverse environments
calo01200  Carbon metabolism
Module
calo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:calo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal7507_4616
   00020 Citrate cycle (TCA cycle)
    Cal7507_4616
   00620 Pyruvate metabolism
    Cal7507_4616
Enzymes [BR:calo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cal7507_4616
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase GCV_H
Other DBs
NCBI-ProteinID: AFY34982
UniProt: K9PQZ7
LinkDB
Position
complement(5237724..5239010)
AA seq 428 aa
MSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
LVPAGESTTVGSAIAYIAETEAEIATAKSLANSGGASTPATPTPQPVAVTASVGTPTLAS
QNGSNHREGRVVVSPRARKLAKELKVDLNTLKGSGPYGRIVAEDVEAAANQGKQPAAKPL
TPQPSTPTIIPTAPAPTPVTSSAIPGQIVPLTTFQNAVVRNMVATISVPVFRVGYTITTD
GLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLINASYSDQGIVYHSDINISVAVAMDDG
GLITPVLKNADIVDIYSLSRTWKSLVERARSKQLQPDEYNSGTFTLSNLGMFGVDTFDAI
LPPGQGSILAIGASTPQVVATGDGLFGVRQQMQVNITADHRIIYGAHAAAFLRDLTKLIE
TNPQSLTL
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgagcattcacgaagtatttatgccggcgctgagttccacgatgactgaaggcaaaatc
gtctcctgggtgaaatcgccaggcgataaagtggagaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttttatgaaggatatcttgcccatatt
ttagtgccagctggtgaaagtacaaccgtgggatctgcgatcgcctatatcgccgaaacg
gaagctgaaattgcaactgctaagtctctagccaattccggtggtgcgtctacccctgct
actcctactcctcaaccagtcgccgtcaccgcctcagtggggacacctaccttagcttct
caaaatggttctaaccaccgtgaaggtagggttgtggtttcaccccgtgcccgtaagtta
gcaaaagaactaaaagttgatttaaatacacttaaaggcagtggcccctacgggcgcatc
gtcgctgaggatgtggaagcagcagcaaatcagggtaagcaaccagccgctaaaccactt
acaccacagccatcgacaccgacaatcatccccacagcacctgcacctactccagtgacc
agcagcgctatacctggtcaaatagtgcccctcactaccttccaaaatgccgtagtgcgg
aatatggtagctaccatctccgttccagtcttccgtgtgggttacacaatcacaactgac
ggcttagacaagctctacaagcagattaagtccaaaggggtgacaatgacagccctacta
gcaaaagctgtagcggtgacattacaaaaacacccattaataaatgctagctattctgac
caaggaattgtttatcattctgacatcaacatttctgtagctgtagctatggatgatggc
ggattgattacacctgtattaaagaacgcagatatagtagacatttattctctatcgcgc
acttggaagtctttagtagaacgcgctagaagcaagcaactacaaccagacgaatataac
agtggcactttcaccctatctaacttgggaatgtttggtgtagacacatttgacgcaatt
ttgccacctggacaaggttcgattttagcgatcggggcgtctactccgcaagtagtagcc
acaggcgatggtttatttggtgtacgccaacaaatgcaagtaaatattactgccgatcac
cgaattatctatggtgcccatgcagccgcattcttgcgagatttgacgaagttgattgag
acaaatcctcaatccttgacactctaa

DBGET integrated database retrieval system