KEGG   Calothrix sp. PCC 7507: Cal7507_4832Help
Entry
Cal7507_4832      CDS       T02358                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
calo  Calothrix sp. PCC 7507
Pathway
calo00010  Glycolysis / Gluconeogenesis
calo00053  Ascorbate and aldarate metabolism
calo00071  Fatty acid degradation
calo00280  Valine, leucine and isoleucine degradation
calo00310  Lysine degradation
calo00330  Arginine and proline metabolism
calo00340  Histidine metabolism
calo00380  Tryptophan metabolism
calo00410  beta-Alanine metabolism
calo00561  Glycerolipid metabolism
calo00620  Pyruvate metabolism
calo00625  Chloroalkane and chloroalkene degradation
calo01100  Metabolic pathways
calo01110  Biosynthesis of secondary metabolites
calo01120  Microbial metabolism in diverse environments
calo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:calo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal7507_4832
   00053 Ascorbate and aldarate metabolism
    Cal7507_4832
   00620 Pyruvate metabolism
    Cal7507_4832
  Lipid metabolism
   00071 Fatty acid degradation
    Cal7507_4832
   00561 Glycerolipid metabolism
    Cal7507_4832
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cal7507_4832
   00310 Lysine degradation
    Cal7507_4832
   00330 Arginine and proline metabolism
    Cal7507_4832
   00340 Histidine metabolism
    Cal7507_4832
   00380 Tryptophan metabolism
    Cal7507_4832
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cal7507_4832
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cal7507_4832
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cal7507_4832
Enzymes [BR:calo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Cal7507_4832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AFY35186
UniProt: K9PQE9
LinkDB All DBs
Position
5495323..5496705
Genome map
AA seq 460 aa AA seqDB search
MVSELTISAVDIIRKQREFFQTGKTKDVYFRIGQLKILKQAIIEHEQAITQTLKADLNKP
EFETYAAEILVTKEIDYAIKHIQTWTKPQKAPVPLNFFPYSAKIYPEPLGVVLIIGAWNY
PFQLTISPLVGAIAAGNCAIIKPSELAPHTSNLLAEIIPKYFDSRYIAVVEGGVETSQKL
LAEKFDHIFFTGSTTVGKIVMTAAAKNLTPVTLELGGKSPCIVDTEINLEHTVKRIVWGK
FINAGQSCIAPDYLLVDKKIKNNLVDILRKTLKEFYGDNPANSPDYARIINHKHFGRLVH
FLKDGEIIIGGKTNSEELYIAPTIINNVSWTDPIMQEEIFGPILPIIEYSDITEAIALIN
SRPKPLALYLFSQNKNLQKRVLQETTSGGVCLNDTMIQFSVSSLPFGGVGDSGIGSYHGK
ASFDTFSHYKSVLQNSFLLDLNWRYAPYKGKLSLLKRLLG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggttagtgaattaacaatttccgctgtggatattattcgtaaacaacgtgaatttttt
caaactggaaaaacgaaagatgtttatttccggattgggcaacttaaaatcttaaagcag
gcaattattgagcatgaacaagcgattacccaaacattaaaagcagatttaaataagcct
gaatttgagacttacgccgcagaaattttagtcaccaaagaaattgattatgccatcaag
catattcaaacttggacaaaaccccaaaaagccccagtaccactgaacttttttccttat
tcagcaaagatttacccagaaccactgggagttgttttgattattggtgcttggaactat
ccctttcaattaactatctcaccattagtaggtgcgatcgctgctggcaattgtgcaatt
attaagccttccgaacttgctcctcatacctctaatctcttagctgagataattcctaaa
tatttcgactcaagatatattgcagtcgtcgaaggaggtgtagaaactagtcaaaaatta
ctggcggagaaatttgatcatatctttttcactggtagcacgactgtaggcaaaattgtc
atgacagcagcggctaaaaatctcacgccagtgactttagaattaggtggaaaaagtcct
tgtattgtagatacagaaattaatctagaacatactgttaaaagaattgtgtggggcaag
tttattaatgccgggcaaagttgtattgctcctgattatcttttagttgataaaaaaatc
aaaaataatctggtagatattctcagaaaaaccctcaaagaattttacggcgataatcct
gctaacagtcctgattatgcccggattatcaatcacaaacattttgggagattggttcat
tttctcaaagatggtgaaattattattggtgggaaaactaattcagaagaactttatata
gctcccacaataattaataatgtctcctggacagatccaatcatgcaggaagagattttt
gggccgattttgccaataattgagtattccgatattacagaagcgatcgccttaattaat
tctcgaccaaaacctttagctttatacttattttctcaaaacaaaaacctgcaaaagcga
gtattgcaggaaacaacatccggtggagtctgtcttaacgacacaatgatacagtttagt
gtttcatctttaccatttggtggtgtgggtgatagcggtatcggtagctatcacggtaaa
gccagttttgacaccttttcccattacaaaagtgtcttgcaaaactcatttttgctggat
ttaaattggcgatatgctccctataaaggcaaactatctttattgaagcgacttcttggg
taa

DBGET integrated database retrieval system