KEGG   Calothrix sp. PCC 6303: Cal6303_0328Help
Entry
Cal6303_0328      CDS       T02372                                 

Definition
(GenBank) Glutathione S-transferase domain protein
Organism
calt  Calothrix sp. PCC 6303
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Glutaredoxin GST_N_4 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: AFY99412
UniProt: K9UU59
LinkDB All DBs
Position
complement(389799..390488)
Genome map
AA seq 229 aa AA seqDB search
MSQIQLYSAILCPFAHQVRLTLLEKGVPFELIEIDPQNKPANFLEISPYGKVPVLKHGDR
HIWESAIVNEYLEEVFPDPPLLPKEPMQRAQARILINFADTQLFATTHKLLISQNPLQQV
EGVNKLTDSLRFIEQEGLQKLSEDESYWLGEEISLVDLTFYPWFEQLVVLEHFRGFQLPS
GLNRLQQWKAKVARRESVRSISNPPEFYLEHYGRLFQMMFDLHQPTLKQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaattcaactttatagtgcaattctgtgtccttttgctcaccaagtgcggtta
accttgctagaaaaaggcgttccttttgagttaatcgaaatcgacccccaaaataagccc
gctaactttctcgaaatttcgccttatggcaaagtccccgtcctcaaacatggcgatcgc
cacatctgggaatcggcgatcgtcaatgagtatctagaggaggttttccctgatccaccg
ctattacccaaggagccgatgcaaagggcacaagcacgaattttgatcaattttgccgat
acccaattgtttgcaacgactcacaaattgttaatcagccaaaatccactccagcaagtg
gagggagtgaataaactgaccgattccttacgatttattgagcaggagggattgcaaaaa
ttatctgaggatgagtcttactggttgggggaagaaatcagtcttgtcgatctgactttt
tatccttggtttgagcaattagtcgtgttggagcatttccgaggctttcagttgccatct
ggactgaatcgacttcagcaatggaaggcaaaagttgctcgccgggaatcagtccgatcg
atctcaaatccgccagaattttatctcgaacattatggacggctatttcaaatgatgttc
gatcttcatcagccaactttgaaacaatga

DBGET integrated database retrieval system