KEGG   Calothrix sp. PCC 6303: Cal6303_2062Help
Entry
Cal6303_2062      CDS       T02372                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K11951  bicarbonate transport system permease protein
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt02010  ABC transporters
Module
calt_M00321  Bicarbonate transport system
Brite
KEGG Orthology (KO) [BR:calt00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cal6303_2062
Transporters [BR:calt02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Bicarbonate transporter [MD:M00321] [OT]
    Cal6303_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFZ01088
UniProt: K9UZ20
LinkDB All DBs
Position
complement(2456370..2457215)
Genome map
AA seq 281 aa AA seqDB search
MTTVQRRSTNPKLNAGNNFISSLQKQFPDFIPPAIALLIFLAIWQLFALTPGATLPGPIQ
VIQDTWILILYPFYDKGGTDKGLFWQILGSLQRVAIGYTLAAIVGIALGVLIGVNRTMSK
ALDPLFQLFRTVPPLAWVPISLAALQKNEPAALFVIFITAIWPILINTAVGVTQIPQDYN
NVAKVLQLSRKDYFINILIPAALPYIFTGLRIAIGLAWLAIIAAEIVMSGIVGIGIFIWN
AYQTNKVSEVILALIYIGVVGLILDKLMAALQNWILPAEQK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgtacaaagacgctctactaaccccaagctaaatgctggtaataactttata
tccagtctgcaaaagcaatttcctgattttatcccacctgcgatcgcgcttttgatcttt
ctcgctatatggcaactatttgccttgactcccggtgcgacattaccaggtccaatacaa
gtaatacaagatacctggatattgattttgtaccctttttatgataagggcggtactgat
aaagggcttttttggcagattttaggcagtttgcaacgagttgcaatcggttatacccta
gcggcaattgttggtattgctttaggtgttttgattggtgttaatcgaacaatgtctaaa
gccttagacccccttttccaactgttccgaactgtaccacccttggcttgggtaccgatt
tctttagcagcgctacaaaaaaatgaaccagcagccctattcgtaattttcatcactgca
atttggccgatcttaattaatactgctgtgggtgtaactcaaattccccaagattacaac
aacgttgccaaagttctacaacttagccgcaaagactatttcatcaatattttgattcct
gctgcattgccctacatttttactggcttaagaattgccattggtttagcttggttagca
atcatcgccgcagaaatcgtcatgtcaggtattgtcggaattggtattttcatctggaat
gcatatcagactaacaaagtcagtgaagtaattttggctcttatttatatcggtgttgtc
ggtttgatcctagataagttgatggctgccttgcaaaactggattttaccagcagaacaa
aagtag

DBGET integrated database retrieval system