KEGG   Calothrix sp. PCC 6303: Cal6303_3043Help
Entry
Cal6303_3043      CDS       T02372                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00630  Glyoxylate and dicarboxylate metabolism
calt00710  Carbon fixation in photosynthetic organisms
calt01100  Metabolic pathways
calt01120  Microbial metabolism in diverse environments
calt01200  Carbon metabolism
Module
calt_M00165  Reductive pentose phosphate cycle (Calvin cycle)
calt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
calt_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:calt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cal6303_3043
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cal6303_3043
Enzymes [BR:calt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cal6303_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFZ01990
UniProt: K9V430
LinkDB All DBs
Position
complement(3604343..3604684)
Genome map
AA seq 113 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDVQITKQVQYILDQGYIPGIEFNETSEPTECYWTMWKLPL
FNSRTTQEVLGEVQQCRSQYANHYIRVVGFDNVKQCQILSFIVHKPNQGGYRY
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttaccaaaagagcgtcgttacgaaaccctatcctaccttcctcctttaacc
gacgttcaaatcaccaagcaagttcaatacatcttggatcaaggttatattcccggaatt
gaatttaacgaaacttctgaacctacagaatgctattggacaatgtggaaattgcctttg
ttcaattcacgcaccactcaggaagttttgggtgaagttcaacaatgtcgttctcagtat
gctaatcactacatccgcgtagttggttttgacaacgttaagcagtgccaaattctcagc
tttattgttcacaaaccaaatcaaggtggttacagatactaa

DBGET integrated database retrieval system