KEGG   Calothrix sp. PCC 6303: Cal6303_3231Help
Entry
Cal6303_3231      CDS       T02372                                 

Definition
(GenBank) Glucan 1,4-alpha-maltohexaosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00500  Starch and sucrose metabolism
calt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:calt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cal6303_3231
Enzymes [BR:calt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Cal6303_3231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AFZ02172
UniProt: K9V429
LinkDB All DBs
Position
3817535..3818998
Genome map
AA seq 487 aa AA seqDB search
MPKVNGTIMQYFHWYIPNDGNLWNELKYRTRDLAGKGFTAMWLPPAYKGAAGGNDVGYGV
YDLYDLGEFDQKGSIRTKYGTHQEYLDAIKTLRQVGIQTYADAVLNHRMGGDSPEIMKAT
PFSQNDRVNPKGGLQEIKSYTYFNFPGRQGKYSQFEWHYWHFDGVDYNKYKEGDNSTVYL
IEGKKFDDFVDMEKGNFAYLMGCDLDFQDQWVQTEITNWGKWYLDTTGVDGFRLDAIKHI
SSWFFPKWIDELEKYAGKELFIVGEYWTPDINTLHWYIDAIAGKMSVFDVPLHYNFSRAS
KLGGNYDMRQILDGTLMQQKPSHAVTFVENHDSQPLQALESVVEPWFKPLAYAIILLRQQ
GYPCVFYADYYGAEYHDKGYHIYLPSHSWLIDKFLSVRQEYVYGHQYDYFDHFNTIGWTC
LGDEEHPKAMAVIMSDGAAGSKWMEVGKIKAKFIDITEHIQEPIYTNEVGWAEFYCNGGS
VSVWVES
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagtcaatggtacaatcatgcaatacttccattggtacatacctaatgatggg
aacctatggaatgaacttaaatatagaactagagacttagcaggaaaaggatttaccgcc
atgtggctacctccagcttataaaggtgcagcaggtggcaatgatgtcggttacggtgtt
tacgatttatatgatctgggtgaattcgaccaaaaaggctcgattcgcactaagtacgga
actcatcaagaatacctagatgccattaaaacccttcgccaagttggaatccaaacctat
gcagatgctgtattaaaccacaggatgggtggagattccccagaaataatgaaagcaact
cccttttcccaaaatgatagagttaatcctaaaggtggtttacaagagattaaaagctat
acctactttaactttcctggaagacagggaaaatattctcaatttgaatggcattattgg
cactttgatggtgtagattacaacaaatataaagaaggtgacaatagtactgtttattta
atcgaagggaaaaagtttgatgactttgtagatatggaaaaaggcaattttgcctatttg
atgggatgtgatttagactttcaagatcaatgggttcaaactgaaattactaattggggt
aaatggtatctcgatacaacaggtgtcgatggattccgcttagatgcaattaagcatatt
tcttcctggttctttcccaaatggatagatgaattagaaaaatatgctggtaaagaacta
tttattgttggtgaatattggactcctgatattaatacattgcattggtatatagatgca
attgccgggaaaatgtcagtctttgatgtgccattacactacaactttagtcgcgcaagt
aagttgggtggaaactacgatatgcgacagattttagatggtacattaatgcagcaaaaa
cctagtcatgcagttacatttgttgaaaaccatgactcccaaccattacaagctttagaa
tcggtggttgagccttggtttaaacctttagcatatgcaattattttgttgcgtcaacaa
ggctatccttgcgtgttttatgctgattactatggcgctgaatatcatgataaaggttat
catatttacctaccatcacatagttggttgatagacaagtttttatctgttcggcaggaa
tatgtttatggtcatcaatatgattattttgaccactttaataccattggttggacatgc
ttaggtgatgaagaacatccaaaagcaatggctgtaattatgagtgatggtgcagcaggt
agtaaatggatggaagttggcaaaatcaaagccaaatttatagatattactgaacatatt
caagagccaatttacaccaatgaagttggttgggcagagttttattgtaatggtggttca
gtttcagtttgggttgaatcataa

DBGET integrated database retrieval system