KEGG   Calothrix sp. PCC 6303: Cal6303_3577Help
Entry
Cal6303_3577      CDS       T02372                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00473  D-Alanine metabolism
calt00550  Peptidoglycan biosynthesis
calt01100  Metabolic pathways
calt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:calt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cal6303_3577
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cal6303_3577
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Cal6303_3577
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:calt01011]
    Cal6303_3577
Enzymes [BR:calt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Cal6303_3577
Peptidoglycan biosynthesis and degradation proteins [BR:calt01011]
 Precursor biosynthesis
  Amino acid ligase
   Cal6303_3577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C RimK ATP-grasp_4 ATP-grasp_3 ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFZ02502
UniProt: K9V4Z5
LinkDB All DBs
Position
complement(4270368..4271405)
Genome map
AA seq 345 aa AA seqDB search
MSVLRVLHLVGSAVDEFYCDLSRLYAQDCLDSTANTELYEFHIAYISPGGTWRFPRDLSS
DAIASAEKVSLSGAIQILISLKIDVMLPQMFCVPGMTFYRGLFDLLKIPYIGNTPDVMAL
AANKAKTKAVVAFSGVSVPQGELLHRGDSPHVTTPAVVKPVDGDNSLGVVLVKNPSDYES
ALKTAFTHSSEVLVETFIELGREVRCGVIVQDNQLVCLPLEEYQMDKEQQPIRSYDDKLK
RNEKGDLSAVAKGNTKSWIVDPSDPITQRVWDVAKKCHIALGCQHYSLFDFRIDPTGKPW
FLEAGLYCSFAQISVIPTMAKTSGISLEKLFHIMLNNLLVYSISN
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtattgcgtgttttacatttggtgggttctgctgttgatgagttttactgcgat
ttgtctaggctttatgctcaagattgtcttgattctactgcgaatacagaactttacgag
tttcacatcgcctacatttcacctggtggtacatggcgctttcctagggatcttagctca
gatgcgatcgcatccgccgagaaagtatcgttatctggtgcaattcagattttaatttca
ctcaaaattgatgtgatgttaccacagatgttttgtgtccctgggatgacattctatcgg
ggtttgtttgatttgctgaaaattccctacatcggaaatactcctgatgtgatggcatta
gctgctaataaggctaaaacaaaagcggttgtggcattttctggtgttagtgtaccccag
ggggaactacttcatcgcggagattctccccatgttactaccccagcagtggttaaacct
gtggatggggataattctttgggggtagttttggtgaaaaatccatctgattatgaaagt
gctttgaaaacagcatttacccatagttcagaagttttggtagagacatttatcgaactt
ggtagggaagttagatgtggtgtcatagttcaagataatcaactggtgtgcttaccactg
gaagaataccagatggacaaagaacagcaacccattcgcagttatgatgataagctaaaa
cgaaatgaaaaaggtgatttgagtgcagttgctaaaggtaataccaaatcatggatagtc
gatcctagtgatccgattactcagagggtttgggatgttgcgaagaaatgccatatagct
ttaggttgtcagcattatagtctatttgacttccgtattgaccccactgggaaaccttgg
tttttagaagcagggttatattgttcttttgcccagataagtgttatccccacaatggca
aaaacatccggaatttctctggaaaagctgtttcacatcatgttaaataacttactagtt
tattctatttctaattaa

DBGET integrated database retrieval system