KEGG   Calothrix sp. PCC 6303: Cal6303_4069
Entry
Cal6303_4069      CDS       T02372                                 

Definition
(GenBank) histidine kinase
  KO
K02482  two-component system, NtrC family, sensor kinase [EC:2.7.13.3]
Organism
calt  Calothrix sp. PCC 6303
Brite
KEGG Orthology (KO) [BR:calt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:calt01001]
    Cal6303_4069
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:calt02022]
    Cal6303_4069
Enzymes [BR:calt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Cal6303_4069
Protein kinases [BR:calt01001]
 Histidine kinases
  NtrC family
   Cal6303_4069
Two-component system [BR:calt02022]
 NtrC family
  Unclassified
   Cal6303_4069
SSDB
Motif
Pfam: HATPase_c HisKA HAUS-augmin3 HATPase_c_5 HATPase_c_3 DUF4795 V_ATPase_I DASH_Dad4
Other DBs
NCBI-ProteinID: AFZ02985
UniProt: K9V6W8
LinkDB
Position
4859440..4860510
AA seq 356 aa
MEPIDYESRIKELEKSVRILQKKLERSEIDRQQLENASDLRESVLKSVIRNLEASEVSLK
QRTEELETTLTNLKSVQMKLIESEKMSALGVLVAGIAHEINNPVSFIYGNLFHAHRYFQD
LITLIDLYQYYYPEPASEIKAKIEKIELSFLKEDLEKLFKSMSMGANRIEKIVKSLRTFS
RLDEAELKKIDIHEGIDSTLVILNSRLKFIPESSRQIEVIRNYGKLPLINCYAGQLNQVF
MNIIANAIDALEEMLETTQTNINLKSRLPTIEIITETINDDWVVVRIRDNGLGMSEKVRS
KLFNPFFTTKDIGKGTGLGLSISYQHVVELHAGKLECNSTLGNGSEFVISIPSKKS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggaaccgatagattacgagagcagaattaaggaattagaaaaaagcgtccgaattctc
caaaaaaaattggaacgttcggaaatagatcgacaacaattagaaaatgctagtgatttg
agggaatcagtcctcaaaagtgtaattcgcaatttggaagcatctgaagtttctctaaaa
caacgtacagaggaattagaaacgacactaactaatctcaaatctgtgcagatgaaatta
attgagtctgagaaaatgtctgctctcggagtcttagttgctggaattgcccacgaaatt
aataatccagttagttttatatatggaaacttattccatgctcatcgttattttcaagat
ttaattacacttatagatttatatcaatattattatcctgaaccagcctcggaaattaaa
gcaaaaattgaaaaaattgaactatcttttctcaaggaagatctagagaaactatttaag
tcaatgagtatgggagcaaatagaatagaaaaaatcgttaagtcactacggactttttct
cgattagatgaagccgaacttaaaaaaatcgatattcatgaaggaattgacagtacatta
gttattttgaatagtcgtctaaaatttatcccagagtcttccaggcaaattgaagtaatt
cggaattacggcaaattacctctgattaattgttatgctggtcagcttaatcaagtattt
atgaatattattgctaacgcaattgatgcattagaagaaatgctggaaacaacacagaca
aacattaatttaaaatctagattaccgactattgaaattattactgagactattaatgat
gattgggttgtggttagaattagagataatggtttaggaatgagcgaaaaagtgcgctct
aaattattcaatcccttcttcacaactaaagacattggcaaaggaacaggcttgggttta
tctattagttatcaacatgttgtggaacttcatgcgggaaagcttgaatgtaattctacc
ctgggaaatggatctgagtttgtgatttctatcccctcgaaaaaaagctaa

DBGET integrated database retrieval system