KEGG   Calothrix sp. PCC 6303: Cal6303_4254Help
Entry
Cal6303_4254      CDS       T02372                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00500  Starch and sucrose metabolism
calt01100  Metabolic pathways
calt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:calt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cal6303_4254
Enzymes [BR:calt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Cal6303_4254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AFZ03163
UniProt: K9V4Z9
LinkDB All DBs
Position
complement(5107376..5109937)
Genome map
AA seq 853 aa AA seqDB search
MQPIRTFNVSPSLPERLEPLRKLAYNLHWDWNAESKDLFRRLDPDLWESSHHNPVAMLGT
ISQDRLTEVVEDEGFLAQMGRAAQQLEDYLQERTWFQKQRTGKPKEYYAYFSAEFGLTDC
LPIYSGGLGVLAGDHLKSASDLGLPLLGVGLLYQQGYFAQYLNADGWQQERYINNDFHNM
PLHLERNADGSELRIEVDYPGRKVYARVWRVQVGSVPLYMMDTNIEPNNAYDQDITDQLY
GGDTDMRIHQEIMLGIGGVRLLKALGYEVTAYHMNEGHAAFSALERTRILIQEKGLSYAT
AKQLVISSNIFTTHTPVPAGIDLFSPDKVLHYLGYYGNIFGLSPEQFLELGRDNPEDDAS
AFSMAVLALKMATFSNGVAQLHGVVSRDMFQGLWKDVPVEEVPIGAITNGVHARSCVSKS
TQELYDRYLGPNWSSVGVDSPLWERMDAIPDEELWRNHERCRLDMILYVREHLVKHLRDR
GASSSVVAQAQEVLDPKVFTIGFARRFATYKRATLWMRDIERIRKILLANKDRKVQFVIA
GKAHPKDIPGKELIQEINHFIREQGLEKQIVFVPNYDIHISRLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADFVRTGWAIGHGEMYDDETYQDEIEANALYDLL
EKEVVPLFYDRDADGLPRHWIAKMKDAIRLNCPFFNTARMVGEYAERAYFHASDRYHTLT
SENYAPAKELAEWKNKLSQNWYNLKIKDINVSSDSDIKVNQTVTVQAKIDLATLTKDDVQ
VELYQGAIDASGEIVNGESVVMENQGIDSHGLSTYTADVVYDTSGLQGLSLRVLPKHKYL
SSAYEPRLIVWAH
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctattcgcacttttaacgtttcaccatcattaccagaacgcttagaaccgtta
cggaaactagcgtacaaccttcattgggactggaatgctgaatcaaaagacttatttcgc
cgtttagatccagatttgtgggagtcaagtcaccacaatccggtggcaatgcttggtacc
attagccaagatcggctcactgaagttgtggaagatgagggctttctcgctcaaatggga
cgtgcagcgcaacagctagaagattatcttcaagaacggacttggtttcaaaagcaacgc
actggtaagcctaaagaatattatgcttatttctccgctgaatttggtttaactgattgt
ttacccatctactcaggtggtttgggggttctagctggtgatcacctcaaatcagctagc
gacctgggtttaccattattaggtgtcggtttactgtatcaacaaggttactttgcccaa
tacctcaacgctgatggttggcaacaagaacgctacatcaacaacgattttcataacatg
ccgttgcacctcgaacgcaacgcagatggttcagaactacgcattgaggttgattaccca
ggacgtaaggtatatgctcgtgtgtggcgcgttcaagtaggttcggtacccctctacatg
atggataccaatatcgaaccaaacaacgcctatgatcaagatattaccgaccaattgtat
ggtggtgataccgacatgcggattcaccaagaaattatgttgggaattggtggtgtgcgc
ttgctgaaggcactaggatacgaagttaccgcgtaccatatgaacgagggacacgccgca
ttttctgcccttgaacgtactcgcatcctgattcaagaaaaaggtttgagttatgctact
gctaaacagttagtaatctcttccaatatctttacaacccatactcccgtacccgcaggg
atcgatctattttcccccgataaggttttacactacctgggttactatggaaacatattc
ggattatccccagagcaattcttagaattgggcagagataatcctgaagatgatgcttct
gcctttagtatggcggttttggcattgaagatggcaaccttctccaatggagttgcccag
ctacatggcgtagtttcccgtgacatgttccagggtttatggaaagatgttcctgtagaa
gaagttcccatcggtgccattactaacggtgttcatgcccgtagttgtgtatccaaatcg
acccaggaactgtacgatcgctatttaggaccaaactggtcatcagtaggagttgatagt
cctttgtgggaacgcatggatgcaattcccgatgaagaattgtggcggaaccatgaaaga
tgtcgcctagatatgattctatatgtacgggaacacctagtgaagcatttacgcgatcgc
ggtgcctcttcatcggtagttgctcaagcacaggaagttcttgatcctaaagttttcacc
atcggttttgcccgtcgttttgctacctacaaacgggcaacattgtggatgcgggatatc
gaaagaatcagaaaaattttactggcaaacaaagacagaaaagttcaatttgtgattgct
ggaaaagcacaccctaaagatatccccggtaaagaattgattcaggaaatcaaccacttt
atccgcgaacaaggtttagaaaaacaaattgttttcgttcccaactacgacatccacatt
tcccggttaatggtggcaggatgcgacatctggttaaatacaccacgtcgtccccgtgaa
gcttccggaactagcggaatgaaagctgcaatgaacggtttgcctaacttaagtgtctta
gatggttggtgggatgaagccgattttgtccgcacaggttgggcaattggacatggagaa
atgtacgatgatgagacatatcaagatgaaatcgaagccaacgcgctgtacgatttacta
gaaaaagaagtagttcccctattttacgatcgtgatgctgatggtttacctcggcattgg
attgctaaaatgaaagatgcaattcgcttaaattgtcccttcttcaacacagcgagaatg
gtgggagagtacgcagaacgcgcttacttccacgccagcgatcgctatcatactctaact
agcgaaaactacgctccagccaaagaactagctgagtggaaaaataaacttagccaaaat
tggtacaatctcaaaatcaaagatatcaacgtctcatctgatagtgatattaaggttaac
cagactgtcaccgtccaagctaaaatcgacttagcaacattaaccaaggatgatgtacag
gtagaattataccaaggtgccatcgatgccagtggtgaaatcgtcaacggcgaatctgta
gtcatggaaaaccaaggtatcgactcccatggtttaagcacttacaccgcagatgtagtc
tatgatacatcaggcttgcagggcttatctctgcgagtattacccaaacacaaatactta
tccagtgcttacgaaccccggctaattgtttgggcacattaa

DBGET integrated database retrieval system