KEGG   Calothrix sp. PCC 6303: Cal6303_4622Help
Entry
Cal6303_4622      CDS       T02372                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00010  Glycolysis / Gluconeogenesis
calt00020  Citrate cycle (TCA cycle)
calt00620  Pyruvate metabolism
calt01100  Metabolic pathways
calt01110  Biosynthesis of secondary metabolites
calt01120  Microbial metabolism in diverse environments
calt01130  Biosynthesis of antibiotics
calt01200  Carbon metabolism
Module
calt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:calt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal6303_4622
   00020 Citrate cycle (TCA cycle)
    Cal6303_4622
   00620 Pyruvate metabolism
    Cal6303_4622
Enzymes [BR:calt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cal6303_4622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase GCV_H
Motif
Other DBs
NCBI-ProteinID: AFZ03522
UniProt: K9V7X1
LinkDB All DBs
Position
complement(5568627..5569922)
Genome map
AA seq 431 aa AA seqDB search
MSIYEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
IVPAGESAPVGNAIAYVVETEAEIAGAVSKATSAAAPATPSIAAKAATNGATTTAAPVAT
TTNASNHREGRIVASPRAKKLAKELKVDLNAIASGSGPFGRIVAEDIEAAAGRVSTPPTV
TAAPAPVAAPPAIPRTAPAPAPVATVVPGQTTPFNALQNAVTRNMVASLTVPVFRANYTI
TTDALDSLYKQIKSKGVTMTALLAKAIALTLKKHPIINASYSEQGIVYHSDINVSVAVAM
DDGGLITPVLRNADAIDIYSLSRTWKSLVERARAKQLQPEEYSTGTFTISNLGMFGVDTF
DAILPPGQGSILAVGASRPQVVATGDGMFGVKQQMQVNITCDHRIIYGADGAAFLRDLAK
LIETNAQSLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcatatacgaagtattcatgcctgcacttagttccaccatgaccgaggggaaaatt
gtttcctgggtcaaatcgccaggtgacaaagtggagaaaggcgaaaccgtggtggttgtg
gagtcagataaggcagatatggatgtggaatccttttatgaaggatacctggcacatatt
atagttccagcgggagaatctgctccagtgggaaacgcgatcgcgtatgtcgtggaaaca
gaagcagaaattgctggggctgtgtcaaaagctacctctgctgctgctcctgcaactcca
tctatagctgccaaagctgccactaatggggcaaccaccaccgccgcaccagttgccact
actacaaatgcctcaaatcaccgcgaagggcgtattgtggcatcaccacgcgccaaaaaa
ctcgctaaagaactcaaagtagacctgaatgcgatcgcatctggtagcggaccctttggc
agaatcgttgctgaggatatcgaagccgctgctggcagagtaagtacacctccaactgtt
actgctgcacctgctccagttgccgcacctccagcaatacctagaacagccccagcacct
gctcctgtagctaccgtagtccccggacaaacaactcccttcaatgcgctccaaaacgcc
gttacccggaatatggtggcgagtttgacagtacctgtattccgtgctaactacactatt
accactgatgccttagatagcctttacaagcagattaaatcaaaaggcgtgactatgacg
gctttgttagcaaaagcgatcgcgctaacgctgaaaaagcaccccatcatcaatgccagc
tattcggagcaaggtattgtttatcactcagatatcaatgtttctgtagctgtagcgatg
gatgatggtggtttaatcaccccagtgttgcgaaacgcggatgcaatcgacatttactcc
ctatctcgcacctggaagtccctcgtagaaagggcaagggcaaaacaactccaaccggaa
gaatacagcaccggaacctttactatttccaacctgggaatgttcggtgttgataccttc
gatgcaattttacctcccggacaaggttcgattttggcagttggtgcttctcgtccccaa
gttgtcgcaacaggtgatgggatgtttggtgtcaagcagcaaatgcaagtaaatattacc
tgcgatcatcgcattatctacggtgctgatggcgctgcgttcttgagggatttagcaaaa
ttgattgaaaccaatgctcaatctttgactctttaa

DBGET integrated database retrieval system