KEGG   Calothrix sp. PCC 6303: Cal6303_4622
Entry
Cal6303_4622      CDS       T02372                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
calt  Calothrix sp. PCC 6303
Pathway
calt00010  Glycolysis / Gluconeogenesis
calt00020  Citrate cycle (TCA cycle)
calt00620  Pyruvate metabolism
calt01100  Metabolic pathways
calt01110  Biosynthesis of secondary metabolites
calt01120  Microbial metabolism in diverse environments
calt01200  Carbon metabolism
Module
calt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:calt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cal6303_4622
   00020 Citrate cycle (TCA cycle)
    Cal6303_4622
   00620 Pyruvate metabolism
    Cal6303_4622
Enzymes [BR:calt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cal6303_4622
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Other DBs
NCBI-ProteinID: AFZ03522
UniProt: K9V7X1
LinkDB
Position
complement(5568627..5569922)
AA seq 431 aa
MSIYEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
IVPAGESAPVGNAIAYVVETEAEIAGAVSKATSAAAPATPSIAAKAATNGATTTAAPVAT
TTNASNHREGRIVASPRAKKLAKELKVDLNAIASGSGPFGRIVAEDIEAAAGRVSTPPTV
TAAPAPVAAPPAIPRTAPAPAPVATVVPGQTTPFNALQNAVTRNMVASLTVPVFRANYTI
TTDALDSLYKQIKSKGVTMTALLAKAIALTLKKHPIINASYSEQGIVYHSDINVSVAVAM
DDGGLITPVLRNADAIDIYSLSRTWKSLVERARAKQLQPEEYSTGTFTISNLGMFGVDTF
DAILPPGQGSILAVGASRPQVVATGDGMFGVKQQMQVNITCDHRIIYGADGAAFLRDLAK
LIETNAQSLTL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagcatatacgaagtattcatgcctgcacttagttccaccatgaccgaggggaaaatt
gtttcctgggtcaaatcgccaggtgacaaagtggagaaaggcgaaaccgtggtggttgtg
gagtcagataaggcagatatggatgtggaatccttttatgaaggatacctggcacatatt
atagttccagcgggagaatctgctccagtgggaaacgcgatcgcgtatgtcgtggaaaca
gaagcagaaattgctggggctgtgtcaaaagctacctctgctgctgctcctgcaactcca
tctatagctgccaaagctgccactaatggggcaaccaccaccgccgcaccagttgccact
actacaaatgcctcaaatcaccgcgaagggcgtattgtggcatcaccacgcgccaaaaaa
ctcgctaaagaactcaaagtagacctgaatgcgatcgcatctggtagcggaccctttggc
agaatcgttgctgaggatatcgaagccgctgctggcagagtaagtacacctccaactgtt
actgctgcacctgctccagttgccgcacctccagcaatacctagaacagccccagcacct
gctcctgtagctaccgtagtccccggacaaacaactcccttcaatgcgctccaaaacgcc
gttacccggaatatggtggcgagtttgacagtacctgtattccgtgctaactacactatt
accactgatgccttagatagcctttacaagcagattaaatcaaaaggcgtgactatgacg
gctttgttagcaaaagcgatcgcgctaacgctgaaaaagcaccccatcatcaatgccagc
tattcggagcaaggtattgtttatcactcagatatcaatgtttctgtagctgtagcgatg
gatgatggtggtttaatcaccccagtgttgcgaaacgcggatgcaatcgacatttactcc
ctatctcgcacctggaagtccctcgtagaaagggcaagggcaaaacaactccaaccggaa
gaatacagcaccggaacctttactatttccaacctgggaatgttcggtgttgataccttc
gatgcaattttacctcccggacaaggttcgattttggcagttggtgcttctcgtccccaa
gttgtcgcaacaggtgatgggatgtttggtgtcaagcagcaaatgcaagtaaatattacc
tgcgatcatcgcattatctacggtgctgatggcgctgcgttcttgagggatttagcaaaa
ttgattgaaaccaatgctcaatctttgactctttaa

DBGET integrated database retrieval system