KEGG   Cicer arietinum (chickpea): 101491072Help
Entry
101491072         CDS       T02819                                 

Definition
(RefSeq) UDP-galactose/UDP-glucose transporter 5
  KO
K15276  solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cam02000]
    101491072
Transporters [BR:cam02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   101491072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UAA EamA TPT
Motif
Other DBs
NCBI-GeneID: 101491072
NCBI-ProteinID: XP_004487040
UniProt: A0A1S2XC14
LinkDB All DBs
Position
Ca1
AA seq 345 aa AA seqDB search
MAESSTTTIGFRDNLWKGIFAISGIMLTLVTYGVLQEKIMRIPYGAEKEYFKYSLFLVFC
NRIMTSAVSAGSLLASKKTLDPVAPIYKYSLVSVSNILTTTCQYEALKYVSFPVQTLAKC
AKMIPVMVWGTLIMQKRYQGPDYLLAFLVTLGCSVFILYPAGTDISPYSRGRENTVWGVL
LMVGYLGFDGFTSTFQDKMFRGYDMEIHNQIFYTTLCSCILSLTGLILQGQMILAVEFVY
RHHDCLFDIALLSTVATISQFFISYTIRTFGALTFATIMTTRQLVSIMLSCVWFSHPLSW
EQWIGAVIVFASLYAKSFWKKAPQRTTSSVALVQKENSNDLKDSP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcatccaccaccacgattggtttcagagataatttatggaaaggcattttc
gccatctccggaatcatgcttaccctcgtcacctatggcgtcttgcaggaaaagatcatg
agaataccatatggggcagaaaaggagtatttcaagtattcactctttcttgttttctgc
aaccgcatcatgacgtctgctgtttctgctggttctttgctggcaagtaaaaaaacattg
gacccagtggctcctatttataagtattcgcttgtgtcagtatcaaacatactaaccaca
acttgtcaatacgaggccctcaaatatgttagttttcctgttcagactcttgcaaagtgt
gcgaaaatgataccggttatggtctggggtacacttatcatgcagaaaagatatcaggga
cctgactatttgttggcttttttagttacccttggctgctcagtatttatcttatatccg
gcaggaacagacataagtccatacagtagaggaagggaaaatacagtttggggtgttctt
ctaatggttggctatcttggatttgatggctttacaagtacattccaagataagatgttt
agaggctatgacatggagatacataatcagatattttatacaacattgtgctcttgtatt
cttagcctcacaggtcttattttacaaggacaaatgatactagcagtagagtttgtatat
cggcatcatgactgtctctttgacatagcattactttcgactgttgcaacaattagtcaa
ttttttatttcctacacaattcgcacttttggtgccctgacatttgctaccataatgacc
acaagacagttggtgagcattatgctatcatgtgtgtggttttcccatcctcttagctgg
gaacagtggattggagccgtcattgtcttcgcctccctttatgcaaaaagtttctggaag
aaagcacctcagaggacaacctcatctgtagcacttgttcaaaaggagaattcaaatgat
ttgaaggacagcccgtga

DBGET integrated database retrieval system