KEGG   Cicer arietinum (chickpea): 101491266Help
Entry
101491266         CDS       T02819                                 

Definition
(RefSeq) uncharacterized LOC101491266
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00061  Fatty acid biosynthesis
cam00780  Biotin metabolism
cam01100  Metabolic pathways
cam01212  Fatty acid metabolism
Module
cam_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101491266
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    101491266
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cam01004]
    101491266
Enzymes [BR:cam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     101491266
Lipid biosynthesis proteins [BR:cam01004]
 Fatty acid synthase
  Component type
   101491266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 101491266
NCBI-ProteinID: XP_012572389
UniProt: A0A1S3EAJ0
LinkDB All DBs
Position
Ca6
AA seq 217 aa AA seqDB search
MASSTLTNTISHTFSPPKSSSLTFPTSRSLHLPTQFRNTTRFTISCSSDSTNSPKQDTTP
IELRYSAFPTVLDINQIREILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFP
ERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRESFFFVGIDKVRFRKPVIAGDTLVMRMTL
IKLQKRFGIAKMEGKAYVGGEIVCEGEFLMATGSASE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttctactctcaccaacaccatctctcacactttttctcctcccaaatcttca
tctctcacatttcccacctccagatctctccatctccccacccagttcaggaacaccaca
cgtttcactatctcttgttcttcagattctacaaattctccaaaacaagacaccacccca
attgaattaaggtattctgcatttccaaccgtattggacatcaatcagattcgtgaaatt
cttcctcataggtttccatttcttctagtggatagagtgattgaatacaatcctggagtt
tctgctgttgctataaagaatgtaacaataaatgacaacttctttcctggacattttcca
gaaagacctatcatgcctggtgttctcatggttgaggcgatggcacaggtgggtggattg
gttatgttacaacctgaagttggaggttctcgtgagagtttcttctttgttgggatagac
aaagtacgatttaggaagccagtgattgctggagacaccttagtaatgagaatgacactt
atcaaactgcaaaagcgatttggaatagcaaagatggaagggaaggcatatgttggaggt
gaaattgtctgtgagggcgagtttttgatggccacaggatctgcgagtgaatga

DBGET integrated database retrieval system