KEGG   Cicer arietinum (chickpea): 101493333Help
Entry
101493333         CDS       T02819                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00250  Alanine, aspartate and glutamate metabolism
cam00410  beta-Alanine metabolism
cam00430  Taurine and hypotaurine metabolism
cam00650  Butanoate metabolism
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101493333
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101493333
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101493333
   00430 Taurine and hypotaurine metabolism
    101493333
Enzymes [BR:cam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101493333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 101493333
NCBI-ProteinID: XP_004503101
UniProt: A0A1S2YE63
LinkDB All DBs
Position
Ca6
AA seq 526 aa AA seqDB search
MFIHPQQTSFIDFVSTMVLSKTSSESDVSVHSTFASRYVRTSLPRFKMPEESIPKEAAYQ
IINDELMLDGNPRLNLASFVTTWMEPECDKLIMASVNKNYVDMDEYPVTTELQNRCVNMI
AHLFNAPLEETEAAVGVGTVGSSEAIMLAGLAFKRKWQNKRKQQGKPYDNPNIVTGANVQ
VCWEKFARYFEVELKEVKLCEGYYVMDPEKAVELVDENTICVAAILGSTLNGEFEDVKRL
NDLLVEKNRETGWDTPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAG
IGWAIWRSKEDLPDELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVM
ENCRDNMLVLKEGLEKTGRFDIVSKDNGVPLVAFTLKDHTHFDEFQISDLLRRFGWIVPA
YTMPPDAQHVTVLRVVIREDFSRTLAERLVVDVEKVLHELDSLPSRMINRSSSTSVAVNE
IVVKNDTDQLVAAKKSALETQREITAVWKKFVLERKKLNDKMNGVC
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttcatccatccacaacaaacaagtttcattgattttgtttccacaatggttctctcc
aagacctcctccgagtccgatgtctctgtccactcaacctttgcttctcgttatgtcaga
acttcacttccaagattcaagatgccggaggagtcgataccaaaggaggcagcataccaa
ataataaacgatgaattgatgctggatggaaatccaagactgaatcttgcatcatttgtg
acaacatggatggaacctgaatgtgataaactcatcatggcttccgttaacaagaattat
gttgacatggatgaataccctgtcaccactgaactccagaatcgatgtgttaacatgata
gctcatctttttaatgcaccacttgaagagactgaggctgcagttggtgttggcactgtt
ggctcatcagaagctataatgttagctggattggcattcaaaagaaagtggcagaacaaa
agaaaacaacagggaaaaccttacgacaatcctaacattgttactggagccaatgttcag
gtttgttgggagaaatttgcaaggtactttgaggtggagctgaaagaggtgaaactatgt
gaaggatactatgtaatggatcctgaaaaggctgtggaattggtggatgagaacactatt
tgtgtagctgctattcttggttcgacattaaatggagagtttgaagatgtgaaacgctta
aatgatctcctagttgaaaagaatagagaaactggatgggatacacctattcatgtggat
gcagctagtggtggattcattgctccatttatttatccagagcttgagtgggatttccgt
ttaccacttgtgaaaagcatcaatgttagtggtcacaaatatggtcttgtctatgctggt
attggttgggctatttggagaagcaaggaagatttgcctgatgaactcatctttcacatc
aactatcttggagctgatcaacctacttttacactcaacttctccaaaggttcaagccaa
gttattgctcaatactaccaactaattcgccttggttatgaggggtacaaaaatgtgatg
gaaaattgcagagacaacatgctagtactaaaagaaggactggaaaaaacaggacgcttc
gacattgtgtcgaaagacaatggtgttcctttagtggccttcacattgaaggaccacaca
cactttgatgaatttcaaatatcggacttgttgcgtcgcttcggatggatagttccggca
tacacaatgcctccagatgcacaacacgtaactgtgttacgtgttgtcataagggaggac
ttttcgaggacattagcggagcgtcttgtggtggatgttgagaaagtgttgcatgagctt
gattcacttccatcaaggatgataaataggagcagcagcactagtgttgcagttaatgaa
atagttgtgaaaaatgacactgatcaactagtggctgctaaaaagagtgctttggagaca
caaagggaaatcactgctgtttggaagaagtttgtgttggagaggaagaagttgaatgat
aagatgaatggtgtttgttaa

DBGET integrated database retrieval system