KEGG   Cicer arietinum (chickpea): 101493373Help
Entry
101493373         CDS       T02819                                 

Definition
(RefSeq) folate synthesis bifunctional protein, mitochondrial
  KO
K13941  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00790  Folate biosynthesis
cam01100  Metabolic pathways
Module
cam_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101493373
Enzymes [BR:cam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     101493373
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     101493373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_bind HPPK
Motif
Other DBs
NCBI-GeneID: 101493373
NCBI-ProteinID: XP_004490212
UniProt: A0A1S2XLS9
LinkDB All DBs
Position
Ca2
AA seq 515 aa AA seqDB search
MNTLKYLGARRSQLCVVRNYLKALGFSSLHTAPNSSIELQTQDEEVVIALGSNVGDRVHN
FKEALKLMRNSGIHITRHACLYETAPAYVTDQPRFINSAVRAITKLGPHELLAALKRIEK
DLGRTVGIRYGPRPIDLDILFYGKFKVRSDILTIPHERIWERPFVMAPLMDLLGTAIDSD
TAASWHSFSGHSGGLSAVWEKLGGESLIGEEGMYRVMPVANGLLDWSQKTLVMGILNLTP
DSFSDGGNFQSVKSAVLQARLMISEGADIIDIGAQSTRPMAPRISVEDELGRLLPVLEAV
SSLPEVKGKLISVDTFYSEVASEAVRRGAHLINDVSAGKLDKNMFKVMADLDVPYVAMHM
RGDPCTMQNSENLKYDNVCKDISSELYSRVREAEMAGIPAWRIIMDPGIGFSKKTEDNLE
VLTGIPDIRADISERSLGISHAPILIGPSRKRFLGEICSRPSAVERDPATVASVTAGVLC
GANIVRVHNVKDNLDAVKLCDAMRRQKSFPMKFRE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaatacactgaagtatctgggggcacgcaggagtcagctctgtgttgtcagaaactac
cttaaagcactgggtttttcctctcttcacacagctccaaactcctctatagaacttcaa
actcaagatgaagaagtagtgattgctttgggaagtaatgtaggtgatagagtccataat
ttcaaggaagccttgaaattgatgaggaactcaggcatacacatcacaagacatgcatgt
ctgtatgaaacagcaccagcgtatgttactgaccaacctcgctttatcaactctgcagta
agagccattactaaactcggtccacatgaattattggctgcactcaaaagaatcgagaag
gacttgggccgtactgttggtataaggtatggtccaaggccaattgacttagatatttta
ttctatggtaaatttaaagtcagatctgatattcttacgatacctcatgaaagaatttgg
gaacgaccgtttgttatggcccctttgatggatttactcggaacagctattgacagtgat
acagcagctagctggcattcattttcaggccattctggtggattatctgctgtatgggaa
aaattaggtggtgaatcccttatcggagaggaaggtatgtatagggtaatgcctgttgca
aatggcttgcttgactggtcgcagaaaacattggtcatgggaatccttaatttgactcca
gatagttttagtgatgggggaaatttccagtctgtgaagtctgctgttttgcaggctcgg
ttaatgatatcagagggtgctgatataattgatattggtgctcagtctactcggccgatg
gcaccaaggatctctgttgaagatgaattaggtagattactccctgtcctggaagctgta
tcatcgttacctgaggtaaaaggaaaactcatatctgttgatactttctactctgaagtt
gcatcagaggcagtgcgtagaggggctcatcttataaatgacgtatccgctgggaaatta
gataaaaatatgtttaaggtcatggcagatcttgatgttccttatgttgcaatgcacatg
aggggtgatccgtgtacaatgcagaatagcgaaaacctgaaatatgataatgtttgcaag
gatatatcctcggaattatactcccgtgttagagaggcagaaatggcgggaatcccagca
tggaggattattatggaccctggaattggattctcaaagaaaactgaagacaatttagag
gtcctcactggaatacccgatatcagggcagatatttcggaaagaagtttgggcatctct
catgctcctatactaattggaccttcaagaaagagatttttaggtgaaatatgctctcgc
ccttctgcggttgagagggatcctgctaccgttgcttctgtcactgccggtgtgttgtgt
ggagctaatatcgttcgagtgcataatgtcaaagataaccttgatgctgtgaagctttgt
gatgcaatgcgaagacaaaaaagttttcccatgaaatttagagagtga

DBGET integrated database retrieval system