KEGG   Cicer arietinum (chickpea): 101494334Help
Entry
101494334         CDS       T02819                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cam03009]
    101494334
Enzymes [BR:cam01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101494334
Ribosome biogenesis [BR:cam03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    101494334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL
Motif
Other DBs
NCBI-GeneID: 101494334
NCBI-ProteinID: XP_004511480
UniProt: A0A1S2YXF7
LinkDB All DBs
Position
Ca8
AA seq 499 aa AA seqDB search
MGFWGIEVKPGKPCPYHADNVQGKLHVTQATLGIGSSTEKSILQCSSGHKSPVYLCSLLP
NKVESCPLNLQFDDEDLVAFSVIGSRSIHLSGFFVADGGDELRDDYEYDSLGEDVGTGTE
ESSEYDSEDGYDDHFFDDSDNDMYPSSPVPNSGVVIEEIPDENQTEIGDEPAKQLVKKEQ
SAHLKEKHSKSSETPDVVRGKNNLLVLESEDEDGFPISTTEKAKSESQKAVAEAKGEQPP
KNTGKSNKKAKDGDNSTSLKRKGASADEDEQQQDGKKKKNKKLKDRVKEEIAHVKETNVT
VLDEKHSEGEEVKATTNQNSVSQAKDGKQANNEVLVEKKNKKKKKKTKESEEVAATKEIA
TAVENQKLATSEKKGKSQAEAKPLQVRTFPNGLVIEEISMGKPDGKRADPGKKVSVKYIG
KLKKDGKIFDSCIGKAPFKFRLGVGEVIKGWDVGVNGMRIGDKRRITVPPSMGYGDKRVG
SIPQNSWLVFDVELIGVAG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctgggggattgaagtgaaacctggcaaaccgtgtccttatcatgctgataat
gtgcaaggaaagcttcacgtcactcaggctactctaggcattggttcatcaacagagaaa
agcatacttcagtgctcttctggacacaaaagtccagtttatttgtgttccttgctgcca
aataaggtcgagtcgtgcccgttgaatcttcagtttgatgatgaggacttggtggcattc
tcggtgattggttcacgaagcatccatctttcaggtttttttgtggctgatggtggcgac
gaacttagggatgactatgaatatgattcattgggagaggacgtgggaactgggacagag
gagtcatctgaatatgatagtgaagatggatatgatgatcacttttttgacgatagtgat
aatgacatgtacccatcttcgccagtcccaaacagtggagttgtgattgaggaaataccc
gatgaaaatcaaactgaaattggagatgagccagctaagcaattggtgaaaaaggaacag
tcagctcacttgaaagagaaacacagcaaaagttctgagactccagatgtcgttagaggc
aagaataacctccttgttctggaaagtgaagatgaagacggtttcccaatttcaaccact
gagaaagctaaatctgagtctcagaaggcagtagcagaagccaaaggagaacaaccacca
aaaaatactgggaaatccaataagaaggcaaaagatggtgataattccactagcttaaag
agaaaaggtgcaagtgctgatgaggatgagcagcagcaagatgggaaaaagaagaagaat
aagaagttaaaagatcgcgttaaggaggaaattgctcatgtaaaagagactaatgttact
gtgctagatgaaaagcattctgagggtgaggaggttaaagctacaaccaaccagaacagt
gtgtctcaggcaaaggatgggaaacaagccaataacgaagtccttgttgagaagaaaaac
aagaaaaagaagaaaaaaaccaaagagtctgaagaagtagctgctacaaaagaaattgct
acagcagttgaaaatcagaagttggctacctctgagaaaaaggggaagagtcaagctgaa
gccaaaccacttcaagtgagaacttttccaaatgggttggttatagaggagatttctatg
ggtaaacctgatggcaaaagagctgatcctggaaagaaggtcagtgttaagtatattggc
aagctaaaaaaagatgggaaaatatttgactcatgtattggaaaggcaccctttaaattt
cgccttggtgtgggagaagtcatcaaggggtgggatgttggcgtcaatgggatgaggatt
ggggacaaaagaagaattacagttccaccatctatgggatatggagacaaacgtgttggg
agtatacctcaaaattcatggcttgtatttgatgttgagttgattggtgttgcaggctga

DBGET integrated database retrieval system