KEGG   Cicer arietinum (chickpea): 101497363Help
Entry
101497363         CDS       T02819                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00564  Glycerophospholipid metabolism
cam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101497363
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     101497363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA FAD_binding_3 Pyr_redox HI0933_like 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 101497363
NCBI-ProteinID: XP_004491933
UniProt: A0A1S2XN70
LinkDB All DBs
Position
Ca3
AA seq 626 aa AA seqDB search
MTRLRKLGTAIGAAAATAYGGAIILSPPFSSNDHGSQLASFEQKIHDPAAVLPSREVQKS
SLIGTSSVKPLDILVIGGGATGSGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIHGGV
RYLEKAVFKLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFDWFEVVYYWMGLKM
YDLVAGARLLHLSRYYSTKESIELFPTLATEGKGRNLRGTVVYYDGQMNDARLNVGLACT
AALAGAAVLNHAEVISLLKDDVGERIIGARIRDNLTGKEFDTYAKVIVNAAGPFCDSVRK
MADKNVRDVICPSSGVHIILPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSNT
PITFLPEPHEDEIQFILDAISDYLNVKVRRSDVLSAWSGIRPLATDPSAKNTESISRDHV
VFEDHPGLVTITGGKWTTYRSMAEDAVNAAIKAGKLITTCGCVTNNLRIVGGEGWDPASF
TVLTQQYVRMKLTHGGKVVPGVMDTAAAKHLSHAYGTLGERVATIAQNENLGKRLAHGYP
FLEAEVAYCARHEYCESAIDFIARRSRLAFLDTDAARRALPRVIQLLAAEHKWDKSRQKE
ELQKAKDFLETFKSSKNAQFYDGKHN
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtctgaggaaactcggcaccgccattggagctgccgctgccacagcttatggc
ggcgcaatcattctctctcctccattttcatccaacgatcatggatctcagctcgcttcc
ttcgaacagaagatccacgatcctgccgccgtcctcccgtccagagaggttcagaagtcg
tcactaatcggtacgagctccgttaaacctcttgatattctcgttataggcggcggagca
accggttccggcgttgcactggatgccgcgacacgtggactccgtgtggggctcgtagaa
agagaggatttctcttctggaacgtcttctcgatccacaaagctcatacatggaggtgtt
cgttacttggagaaagctgtgttcaaacttgactatggccaactgaagttagtattccat
gcgctggaggagcgtaaacaggttattgacaatgcaccacacctatgccatgctttacct
tgcatgacaccatgttttgactggtttgaagtagtgtactattggatgggcttgaaaatg
tacgatctcgtagcaggagcccggcttttgcatttgtcaagatactattctacgaaagag
tccattgagctctttcccactttggcaacggaaggaaaaggtagaaacctgaggggcaca
gttgtttattatgatggtcagatgaatgatgcacgactgaatgttggattggcttgcacg
gctgcgttggctggtgcagcagtgctgaaccatgctgaagttatatccttattgaaggat
gatgttggtgaacggataattggtgcacgaattagggacaatttaactggcaaagagttt
gatacctacgcaaaagtaattgtgaatgcagctggtccattttgcgattcagtaaggaaa
atggctgacaaaaatgtacgagacgtgatttgtccaagtagtggtgtacatattatactc
cccgattattattctcccgagggtatgggcttaattgttcctaaaactaaggatggacgc
gttgtttttatgctaccttggctgggaagaactgttgctggaactacagattcaaacact
cccattacttttcttccagaaccacatgaagatgaaatacaatttatattggacgccata
tctgactatcttaatgttaaggttcgacgctctgatgttctttctgcctggagtggcatt
cgaccgttagcaacggacccatcagctaaaaatactgaaagcatctcaagggatcatgtt
gtgtttgaagatcaccctggtttggtcaccattactggtggcaagtggaccacatatcgc
agcatggctgaagatgctgttaatgcagctataaaggctgggaaactgatcaccacctgt
ggatgtgtgaccaacaacctaagaattgttggtggtgaagggtgggatccagcttctttt
acagttctcacacaacagtatgtacgcatgaaattaacacacggggggaaagttgttcct
ggggtaatggacactgctgcagcaaaacatttgtctcatgcatatggaacgttgggtgaa
cgtgtggccaccattgctcagaatgaaaatttgggtaagcggcttgctcacggttaccct
tttttggaggctgaggtggcttactgtgctcgccatgaatactgcgaatcagccattgac
ttcatcgcaaggaggtctcgacttgctttccttgacactgatgcagcgagacgggcatta
cctcgcgtgattcaattattggcagctgagcataagtgggacaaatcaaggcaaaaggaa
gagctgcagaaggctaaagattttttggagacttttaaatcctccaaaaatgctcagttc
tatgatgggaagcacaattga

DBGET integrated database retrieval system