KEGG   Cicer arietinum (chickpea): 101498700Help
Entry
101498700         CDS       T02819                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam03030  DNA replication
cam03410  Base excision repair
cam03420  Nucleotide excision repair
cam03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cam00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101498700
   03410 Base excision repair
    101498700
   03420 Nucleotide excision repair
    101498700
   03430 Mismatch repair
    101498700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cam03032]
    101498700
   03400 DNA repair and recombination proteins [BR:cam03400]
    101498700
Enzymes [BR:cam01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101498700
    6.5.1.6  DNA ligase (ATP or NAD+)
     101498700
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101498700
DNA replication proteins [BR:cam03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101498700
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101498700
DNA repair and recombination proteins [BR:cam03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101498700
   NER (nucleotide excision repair)
    Other NER factors
     101498700
   MMR (mismatch excision repair)
    Other MMR factors
     101498700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 101498700
NCBI-ProteinID: XP_004493055
UniProt: A0A1S2XS06
LinkDB All DBs
Position
Ca3
AA seq 1362 aa AA seqDB search
LPSSSSPSSIPHSKLIPNTRFLIDAFRHSVDFSVSYFLSHFHSDHYTGLSSSWSRGIIYC
SPTTALLLLRILNIPSPFIHPLPLHQPVLIDGSHVTLIDANHCPGAVQFLFHVPSSGKSF
RYIHTGDFRFSPSMILDPALGSFIGADAVFLDTTYCHPKFVFPSQDESVNYVVDVVNQCD
GGDDVLFLVATYVVGKEKILLELARRLGKKVHVDARKMEVLEALGYGESGEFTEDVLQTN
IHVVGWNVLGETWPYFRPNFVRMKEIMIERGYSKVVGFVPTGWTYEVKHGKFAVRSKDSC
RIHLVPYSEHSNYDELREYVRFLKPKKVVPTVGLDVEKSDSKHVDKMRKYFARLVDETAN
KKEFLKGFKKCDSGVVGFEAGKDVIDDSEPGQSIEKEVKPSDTGEDKSINLDVVASLSSS
TVETCIQDPILLNDEEKEKVIQEISCCLPTWVTRSQVLDLINISGSNVVEAVSYFLERET
EFHEQVNSGQSSVPTPKCCSSNDTSPISKSNINTNTTFKKLDIFPSPDSKFTTLRHTLPN
HISPSKRKRRSESKPNKKVNVKAKSESSGSKQSTITKFFSKAMPKNPSDTQSDQFGSKPD
ESSKVEELLPTEAGNLYKHEIDQFIQIINGNESLKTQAITIIEKAKGDIDKALDIYYCNS
CNLGENEISVQGESKIDRPLEKKHVSQELRVIPDISMHKVLKDNVDATHVSLPSEKYNPK
EHACWRDGQPAPYLHLARTFNLLGDEKGKIKATSILCNMFRSLLALSPEDVLPAVYLCTH
KIAADHENVELNIGGSLVTTALEEACGTNRLKIREMYNKFGDLGDVAQECRQTQRLLAPP
TPLLIKDVYSALRKISVQTGNGSTLRKKGIIVHLMRSCREKEMKFLVRTLIRNLRIGAML
RTVLPALAHAVVMNSCPNVQQEGTAENLKATLQVLSVAVVEAYNIVPNLDIIVPSLMNKG
IEFSVSSLSMVPGIPIKPMLAKITNGIPQALKLFQNKAFTCEYKYDGQRAQIHKLVDGSI
RVFSRNGDESTSRFPDLIDMITESCKPVASTFIIDAEVVGIDRKNGYRIMSFQELSSRGR
GGKDTLVTKESIKVGICVFVFDIMFANGEQLLGFPLRLRRKYLKDFFYDERPGYFEYAKE
TTIEADDACLTCEATLTKVNAFLEDALRSSCEGIMVKSLDIVAGYSPSRRSDKWLKVKRD
YMEGLNDTLDLVPIGAWHGNGRKAGWYSPFLMACFNPETEEYQSVCRVMSGFSDSFYIEQ
MKEFFSGDKVLSKKPPYYQTGETPDMWFCPQLVWEIRGADFTVSPVHHAAIGLVHPSRGI
SIRFPRFISSVSDRNPEECSTAADIVEMFHSQKRKMDVTTEG
NT seq 4089 nt NT seq  +upstreamnt  +downstreamnt
ctcccatcttcatcttcaccgtcctccattccccactccaaactcatccctaacacccgc
ttcctcatcgacgctttccgccactccgtcgacttctccgtttcctactttctctctcat
ttccactccgatcactacaccggcctctcctcctcttggtctcgcggcatcatctactgt
tcccccaccaccgccctcctcctcctccgcatcctcaacatcccttcccctttcatccac
cctctccccctccaccaacctgttctaatcgatggctcccatgtcactctcatcgacgcc
aatcactgccccggcgccgttcagttcctcttccacgttccctcgtcaggaaaatccttt
aggtacattcataccggtgattttcggttttctccttcaatgatattagaccctgcactt
ggttcatttattggtgctgatgctgtatttttggatacaacttattgtcaccctaagttt
gtttttccttcgcaagacgagtctgttaattatgttgttgatgttgtaaatcagtgtgat
ggtggcgatgatgtgttgtttcttgttgctacttatgttgttggtaaggagaagattttg
cttgagcttgctaggaggttaggaaagaaggtacatgtggatgctaggaaaatggaggtt
ttggaggctcttgggtatggagagagtggtgagtttactgaggatgttttacagactaat
attcatgttgttggatggaatgtgttgggggagacttggccgtattttagacctaatttt
gttaggatgaaggagattatgattgagaggggctactcaaaggttgtgggttttgtgcct
actggctggacttatgaagtgaagcatggtaagtttgctgttaggtctaaggattcgtgt
cggattcatcttgtgccttatagtgagcattcaaactacgatgagcttagggaatatgtg
aggtttttgaaaccgaagaaggttgttccgactgtgggtttagatgttgagaagagtgat
agtaaacatgttgacaaaatgaggaagtattttgctaggttggttgatgagacggctaac
aagaaagagtttttaaagggttttaagaagtgtgattccggtgtagtgggttttgaggcc
ggtaaggatgttattgatgattcggaaccagggcagagcattgagaaagaagtgaagcca
tctgatacgggagaggataaaagtattaatctggatgttgttgcgagtctgtcatcttct
acggtagaaacttgcatacaagatcctatattgctaaatgatgaagaaaaagagaaagtc
attcaagaaattagttgttgtttgcccacctgggtcacccgaagccaggtgttagatctg
atcaacatctctggcagcaatgttgttgaagctgtttcttatttccttgaacgtgaaact
gagtttcacgagcaagtaaattccggtcaatcttcagttccaacacccaagtgttgctca
tcgaatgacaccagtcctatttcaaaatcaaacatcaatacaaacaccaccttcaaaaaa
ctggacatttttccaagtccagactctaaattcactaccctaaggcacacattaccaaat
cacatttccccttccaaaagaaagaggagaagtgaaagtaagccaaacaagaaagtaaat
gtcaaagcaaaatcagaatcaagtggttcaaagcagtcaacaataacaaaattctttagc
aaagcaatgcctaagaatcctagtgatacccaatctgatcaatttggatcaaaacccgat
gaaagctccaaagttgaagaattgttgcccactgaggctgggaacttgtataagcatgag
attgatcagtttatacaaataataaatgggaacgagtcattaaaaacgcaagcaattact
ataattgagaaggcaaaaggagatatcgataaggcattggatatatattactgcaattct
tgcaatctaggtgaaaatgagatatcagttcaaggggaaagcaaaattgacagaccttta
gagaagaagcatgtgtcacaagagttgagagttatacctgatatttctatgcataaagtg
ttaaaagataatgtagatgcaactcatgtatctctaccatctgagaaatacaaccccaag
gaacatgcgtgttggagagatggacagcctgcaccatatttacatcttgcacgaaccttc
aacctgcttggggatgagaaaggaaagataaaagctacttcaatactgtgcaatatgttc
agaagtttgttggccttgtctccagaagacgtgcttcctgctgtgtatctatgtacacac
aaaattgctgcagaccatgaaaatgtggaactaaatattggtggaagtttagtcactaca
gcacttgaagaggcatgcgggacaaatagattgaaaataagggagatgtataacaaattt
ggcgaccttggtgatgttgctcaagagtgtcgtcaaacacagagattgctcgcaccgcct
acaccgcttctaattaaggatgtttactctgcactacgaaagataagtgtacaaacaggc
aatggaagcacattacggaagaaaggcatcattgttcatctcatgcgttcctgccgtgaa
aaggagatgaagtttcttgttcggaccttgatcaggaacttgaggatcggagcaatgctt
agaactgttttgcctgcattagctcatgctgttgttatgaattcttgtccaaatgtgcag
caagaaggaacagctgaaaatttgaaggcgacacttcaggtcctttccgtggcagttgtt
gaagcatataacatagtgccaaatttggatatcatagtcccatctctcatgaacaaaggc
attgagttttcagtttcgagtttatcaatggttccaggaatcccaattaagcctatgctt
gcaaagattaccaatggcattccccaagcactgaagctatttcaaaataaagcatttaca
tgtgaatataagtatgatggtcagcgagctcaaattcacaaattagttgatggatcaatt
cgtgttttttcaagaaacggagatgaatcaacttcgagattccctgatctgattgacatg
ataacagaatcttgcaagcctgttgcatcaacattcataatcgatgcagaggttgttggt
attgatagaaaaaatggatataggattatgtctttccaggagttatcttcacgcgggaga
ggaggcaaagatactttagttactaaagagagcataaaggtgggcatttgcgtctttgtc
ttcgatatcatgtttgcaaatggagaacagttactgggttttcctctccgcctaaggcga
aagtatctgaaggattttttctatgatgaacgacctgggtattttgaatatgcaaaagaa
acaactattgaagcagatgatgcttgcttaacgtgtgaagccacattaactaaagtaaat
gctttcctagaagatgcactccgctcttcatgtgaaggaattatggtgaaatcattggat
attgtagctgggtattctccatcaaggcgttctgacaaatggttaaaggtcaagcgagat
tatatggaaggattaaatgatactcttgatttagtaccaattggtgcatggcatggaaat
ggaaggaaagctggatggtatagtccatttctcatggcatgtttcaatcctgaaactgag
gagtatcaaagtgtatgccgagtgatgtctgggttctcagactcattttacatagagcag
atgaaagaattcttctctggggacaaagtgttgtcaaaaaagccaccatattatcaaaca
ggagagacaccagacatgtggttttgtccacaacttgtttgggaaataagaggtgcagac
ttcacagtatccccagttcatcatgctgccattggtttagttcatccatctcgaggcatc
tcaattagatttccaaggtttattagcagtgtgtcagacagaaaccccgaagaatgtagc
acagctgccgatatagttgaaatgtttcattcgcagaaacggaagatggatgtcacaact
gaaggttga

DBGET integrated database retrieval system