KEGG   Cicer arietinum (chickpea): 101500264Help
Entry
101500264         CDS       T02819                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00620  Pyruvate metabolism
cam00710  Carbon fixation in photosynthetic organisms
cam01100  Metabolic pathways
cam01200  Carbon metabolism
Module
cam_M00168  CAM (Crassulacean acid metabolism), dark
cam_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cam_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cam_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    101500264
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101500264
Enzymes [BR:cam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     101500264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 101500264
NCBI-ProteinID: XP_004487157
UniProt: A0A1S2XCC6
LinkDB All DBs
Position
Ca1
AA seq 965 aa AA seqDB search
MATRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGQDIRQTVQDC
YELSAEYEGNHESEKLEELGNMLTGLDAGDSIVISKSFSHMLNLANLAEEVQIAYRRRIK
LLKKGDFADENSAITESDIEETLKRLVTELKKTPEEVFDALKNQTVDLVLTAHPTQSIRR
SLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEXXXX
XXXFHETIWKGVPKFLRRVDTALKNIGINERIPYNAPVIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYFSQIEDLMFELSMWRCNDDLRVRAHELHRSSKRDAKHYIEFWKQI
PPNEPYRVILGFVRDKLYNTRERARQLLANGTSDIPEETTFTNVEQFLEPLELCYRSLCA
CGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITKHLEIGSYREWSEES
RQEWLLSELSGKRPLFGHDLPKTEEIADVLETFRVISELPSDNFGAYIISMATSPSDVLA
VELLQRECHVKQPLRVVPLFEKLADLESAPAAVARLFSIDWYRNRIDGKQEVMIGYSDSG
KDAGRLSAAWALYKAQEELINVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALLDEMAVIAT
KEYRSIVFQEPHFVEYFRCATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGEAFKHAIEKDPKNLQMLQDMYNQWPFFRVTLDLVEMVFAKGDPGIAALYD
KLLVSKALRPFGERLRAKFEETKSFLLKVAGHKDLLEGDPYLKQRLRLRDSYITTLNVLQ
AYTLKQIRDPDYVKMRPHLSKDYMESSKPAAELVKLNPKSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctactcgaaacattgagaagatggcttcaattgatgctcagctgagattattggca
ccaagaaaagtttctgatgatgacaaacttgtggagtatgatgctttgttgttggatcgt
ttccttgacattcttcaggatttgcatggacaagatatcagacaaactgttcaagattgt
tatgagctatcagcagagtatgaagggaatcatgagtctgagaagttggaggaacttggg
aatatgttgactggtcttgatgctggagattctattgtcatatccaaatcattttctcac
atgcttaatttggcaaacttggctgaggaagttcaaattgcatataggagaaggatcaag
ttattgaagaagggtgattttgctgatgaaaattctgctataactgagtcagatattgaa
gaaactttgaagaggcttgtgactgaactgaagaagactcctgaagaagtctttgatgct
ttgaaaaatcaaactgtagatttggtcttaactgctcatcctactcagtctattaggaga
tctttgcttcaaaagcatggaaggataaggaattgcttaacacagttgtatgctaaagac
ataacaccagatgataagcaggaacttgatgaggctttacagagagagattcaagctgca
tttcgcacagatgaaattcgaaggactcctcctacaccacaagatgagnnnnnnnnnnnn
nnnnnnnactttcatgagacaatttggaaaggagtgccgaagtttttgcgtcgggttgat
acagctctaaagaacattggaataaatgaacgtatcccatataatgctcctgttatccaa
ttctcttcttggatgggaggagatcgtgacggtaatcctagggtaacccctgaagttaca
agggatgtgtgtttgctcgctcgaatgatggctgctaatttgtacttctctcagatagag
gatctcatgtttgagctgtctatgtggcgctgcaacgacgatcttcgtgttagagctcat
gagcttcatagatcctcaaagagagacgcaaaacattatattgagttttggaaacagatt
cctccaaatgagccatatcgtgtcattcttggattcgtgagggacaaactgtataataca
cgcgaacgtgctcgccagttattagctaatgggacctctgacatccctgaagagacaacc
ttcacaaatgttgagcagtttctggagcctcttgaactctgttatagatcactttgtgca
tgcggtgaccgaccaatagcagatggaagcctactcgatttcttgcgtcaagtttctaca
tttggactttcacttgtaaggctcgatattcgccaagagtcggacagacacactgatgtt
atggatgcaattacaaaacacttggagattggatcataccgagaatggtcagaggaaagc
aggcaggaatggctcttatccgagcttagtggaaagcggcctctatttggccacgacctt
cctaaaacagaagaaattgctgatgttttagaaaccttccgtgtcatttcagaacttcct
tcggacaactttggcgcttatataatctcgatggcaacatctccatctgatgtgcttgct
gtcgagcttttacaacgcgaatgtcatgtgaagcagcctttaagagttgttccactgttt
gaaaagcttgctgatcttgagtctgctccagctgcagtagcgcggcttttctcgatagat
tggtacagaaaccgcattgatggtaagcaagaagttatgataggatactcagactcagga
aaagatgcgggccgtctttcagcagcttgggcactatacaaggctcaagaggaactcata
aatgtagcaaaggagtttggtgttaagctaacaatgttccacggccgaggagggacagtt
ggaagaggaggaggtcctactcatcttgctatattgtctcagccaccggatactattcat
ggctcacttcgggtaactgttcaaggtgaagttattgaacagtcatttggagaggagcac
ttgtgctttagaacacttcagcgtttcactgctgctacacttgagcatggaatgcatcct
cctgtgtcgcctaaacctgaatggcgtgcccttttggatgagatggctgtcattgcaacc
aaggaatatcgctccattgttttccaagaacctcattttgttgaatactttcgatgcgcg
actcctgagttggaatatggacgaatgaacattggcagccgtccatcgaaacgaaagcct
agtggaggcatcgaatctcttcgcgctattccttggatttttgcttggacacaaacaagg
tttcatttacctgtatggcttggctttggagaagcattcaagcatgcaattgagaaagat
ccaaagaatctccaaatgcttcaagatatgtataatcaatggcctttcttcagggtcact
cttgacttggttgagatggttttcgccaaaggagaccccgggattgctgccttatatgac
aaactcttagtttcaaaagcactgcgtccatttggtgagcgtttacgggctaaatttgaa
gaaaccaagagctttcttctcaaggttgccgggcacaaggatcttctcgaaggagatccc
tacttaaagcaaagactacgccttcgagactcttatatcacaaccctaaatgtattgcaa
gcttacacattgaagcaaattcgcgatccagactatgtgaagatgaggcctcatttgtca
aaggattatatggaatcaagcaagccagcagcagaacttgttaaacttaatccaaaaagt
gagtatgctcctggtcttgaagacacccttattttgactatgaagggtatagctgctggc
atgcaaaacacaggctaa

DBGET integrated database retrieval system